╔╜ Evanger's Super Premium Dog Food Chicken with Brown Rice 16.5 lbs »

To contact us Click HERE
My mate said to me regarding Lamb And Rice Dog Food and he launched the object is Evanger's Super Premium Dog Food Chicken with Brown Rice 16.5 lbs. When I hear my good friends chat about the options of the product. The following day, I considered to get Evanger's Super Premium Dog Food Chicken with Brown Rice 16.5 lbs. After applying this item, I am very satisfied. Aspect of fascination are seeing that follows.

Evanger's Super Premium Dog Food Chicken with Brown Rice 16.5 lbs

List Price : $26.45
Price : $35.55
Note: This price update on October 11, 2012
Check current price Click Here » at Amazon.com

Evanger's Super Premium Dog Food Chicken with Brown Rice 16.5 lbs

Product Description

Made with Evanger's same superior, high quality nutrition, this is the perfect compliment to our canned entrees.

• Complete nutrition
• Not Kosher

See All Buying Option
At Amazon.com

Lamb And Rice Dog Food

Tag: Evanger's Super Premium Dog Food Chicken with Brown Rice 16.5 lbs

Cats don't Prefer Sweets

To contact us Click HERE

Cats taste the world very differently than humans

One thing that I found fascinating during my undergraduate studies was my Modern Biology class. It involved learning about and implementing numerous techniques that are rather new to the field of biology. Thanks to this class, I isolated a number of different cell components, ran various biological molecules through a gel electrophoresis machine, and performed polymerase chain reaction. I also took my own DNA and prepared it for sequencing, which involved refining and isolating the material, cutting out the gene we wanted to look at, then replicating it so that it could be sent off for the actual sequencing process to be performed.

The gene that we looked at was one of the two that go into making the receptors on your tongue that register sweetness. Specifically, the TAS1R2 (taste receptor, type 1, member 2) gene. TAS1R2 must join up with a second protein to signal that sweet flavor. Here is the TAS1R2 gene (specifically, my copy) in its three hundred fifty-five nucleotide entirety: 

GCTGCGTACCACACCCAGCGCCGACCACCACATCGAGGCCATGGTGCAGCTGATGCTGCACTTCCGCTGGAACTGGATCATTGTGCTGGTGAGCAGCGACACCTATGGCCGCGACAATGGCCAGCTGCTTGGCGAGCGCGTGGCCCGGCGCGACATCTGCATCGCCTTCCAGGAGACGCTGCCCACACTGCAGCCCAACCAGAACATGACGTCAGAGGAGCGCCAGCGCCTGGTGACCATTGTGGACAAGCTGCAGCAGAGCACAGCGCGCGTCGTGGTCGTGTTCTCGCCCGACCTGACCCTGTACCACTTCTTCAATGAGGTGCTGCGCCAGAACTTCACTGGCGCCGTGTGG

...not really that interesting.

This is your average TAS1R2 gene for Homo sapiens, nothing special. Just about every human out there has this exact sequence, with few exceptions (one of my classmates, for example, had a single point mutation). However, it is one gene crucial to why humans like sweets so much. This is what the gene looks like after it's been translated into its protein form (the letters are standard for amino acids):

Query  2    LRTTPSADHHIEAMVQLMLHFRWNWIIVLVSSDTYGRDNGQLLGERVARRDICIAFQETL  181            LRTTPSADHHIEAMVQLMLHFRWNWIIVLVSSDTYGRDNGQLLGERVARRDICIAFQETLSbjct  82   LRTTPSADHHIEAMVQLMLHFRWNWIIVLVSSDTYGRDNGQLLGERVARRDICIAFQETL  141Query  182  PTLQPNQNMTSEERQRLVTIVDKLQQSTARVVVVFSPDLTLYHFFNEVLRQNFTGAVW  355            PTLQPNQNMTSEERQRLVTIVDKLQQSTARVVVVFSPDLTLYHFFNEVLRQNFTGAVWSbjct  142  PTLQPNQNMTSEERQRLVTIVDKLQQSTARVVVVFSPDLTLYHFFNEVLRQNFTGAVW  199 

This is a comparison showing my own protein versus the average human. It's a perfect match and codes for a fully functional receptor protein. This gene is seen in a very wide variety of different animals, and the shared genetic material is quite astounding, allowing for countless species to have the ability to taste sweetness.

A cat enjoying a fresh fish

So, why am I talking about humans a post about cats? Well, let's compare the sequence above to the equivalent gene in a cat. The "query"line is the human gene again, and the "sbjct" or subject line is the equivalent gene in Felis silvestris catus.

Query  2    LRTTPSADHHIEAMVQLMLHFRWNWIIVLVSSDTYGRDNGQLLGERVARRDICIAFQETL  181            LRT P+ +H   AM  ++ +FRWNW+  + + D YGR   +   E    RDICI F E +Sbjct  184  LRTIPNDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKFREEAEERDICIDFSELI  243Query  182  PTLQPNQNMTSEERQRLVTIVDKLQQSTARVVVVFSPDLTLYHFFNEVLRQNFTGAVW  355                 +Q    EE Q++V ++   Q STA+V+VVFS    L     E++R+N TG +WSbjct  244  -----SQYSDEEEIQQVVEVI---QNSTAKVIVVFSSGPDLEPLIKEIVRRNITGRIW  293

Cat tongue anatomy

Overall, the genes are fairly similar, but with one major difference. I'm not going to get too complicated with this, but the dashes you see indicate amino acids that are absent in the final protein found in cats but present in humans: a deletion. Changes in a protein don't necessarily result in a change in its functionality, but that deletion is enough to result in the cat's protein being non-functional. Since the protein cannot bond to molecules of sugars or sweeteners, cats simply cannot register the sensation of sweetness. This deletion seems to be unique to the cat family, since other carnivores, such as dogs and bears, have a functioning gene. From what I remember, big cats have this non-functioning gene as well, but it isn't known whether or not the cat allies (such as civets and genets) share this unusual feature.

Though cats aren't able to taste sweetness, this doesn't mean they will avoid it. They are, in fact, completely indifferent to the flavor. So, if your kitty likes something sweet, it's probably going after something other than the sugar. They're quite fond of certain amino acids, so it's possible that's what your kitty enjoys.

Sources Basic Local Alignment Search Tool (BLAST), PLOS Genetics, Journal of Nutrition, and GeneCards. Images are from Wikimedia Commons under Creative Commons licenses: one, two, three.

By the way, BLAST is an amazing tool. Feel free to plug in the ATCG sequence above into their databases to compare the gene for yourself. The programs I used for this post are nucleotide blast and blastx.

Ebon's Mother

To contact us Click HERE
I was finally able to snag a good picture of her for the blog. Most of the pictures I have or can find aren't so great (example). This is Ebon's mother, Hellon, who will be fifteen this Christmas. She has some mobility issues (what dog this age doesn't?), but she's still doing pretty well. I kept miscalculating her age, but I know for sure now. She has the most fascinating graying pattern. I love looking at old dogs and seeing where and when they gray. A lot of them aren't as extensive as this!

Hellon is about sixty pounds and is a retired working dog, retrieving ducks regularly in her younger days. Ebon was the runt from her last litter and ended up being the biggest of them when he finished growing. She was spayed when he was about a year old. She currently lives with a Shih Tzu, but when Ebon was born she had an elderly Pekingese companion. Image is from her owner, used with permission.

 I bet Ebon will look like this one day.

Feline's Pride food recalled due to salmonella

To contact us Click HERE

Feline’s Pride Issues Nationwide Recall of its Natural Chicken Formula Cat Food Due to Salmonella Contamination

Contact:
Shelby Gomas,
Tel: 1-716-580-3096

FOR IMMEDIATE RELEASE - July 1, 2010 - Buffalo, NY – Feline’s Pride is announcing a voluntary recall of Feline’s Pride Raw food with ground bone for cats and kittens, Natural Chicken Formula, Net Wt. 2.5 lbs. (1.13 kg., 40 oz.) produced on 6/10/10, because it may be contaminated with Salmonella. People handling raw pet food can become infected with Salmonella, especially if they have not thoroughly washed their hands after having contact with the raw pet food or any surfaces exposed to the product.

When consumed by humans, Salmonella can cause an infection, salmonellosis. The symptoms of salmonellosis include nausea, vomiting, abdominal cramps, minimal diarrhea, fever, and headache. Certain vulnerable populations, such as children, the elderly, and individuals with compromised immune systems, are particularly susceptible to acquiring salmonellosis from such pet food products and may experience more severe symptoms.

Pets with Salmonella infections may be lethargic and have diarrhea or bloody diarrhea, fever, and vomiting. Some pets will have only decreased appetite, fever and abdominal pain. Infected but otherwise healthy pets can be carriers and infect other animals or humans. If your pet has consumed the recalled product and has these symptoms, please contact your veterinarian.

The product is packaged in uncoded plastic containers and sold frozen to private consumers nationwide. Once thawed, the pet food has a shelf life of about 1 week. The firm manufactures the pet food by an as-ordered basis. This recall affects only those orders placed and shipped from June 10 through June 17, 2010.

The firm and FDA are investigating this matter to determine the source of this problem, and will take any additional steps necessary to protect the public health.

To date, both the firm and the FDA have received no reports of Salmonella infection relating to this product.

This product should not be fed to pets but should instead be disposed of in a safe manner (e.g., in a securely covered trash receptacle). People who are experiencing the symptoms of Salmonella infection after having handled the pet food product should seek medical attention, and report their use of the product and illness to the nearest FDA office.

People should thoroughly wash their hands after handling the pet food – especially those made from raw animal protein such as meat or fish -- to help prevent infection. People may risk bacterial infection not only by handling pet foods, but by contact with pets or surfaces exposed to these foods, so it is important that they thoroughly wash their hands with hot water and soap.

Since certain vulnerable populations, such as children, the elderly, and individuals with compromised immune systems, are particularly at risk from exposure they should avoid handling this product.

Consumers with questions should contact the company at (716) 580-3096, Monday –Friday from 10 am - 4 pm EDT.

Feline's Pride expands food recall due to salmonella

To contact us Click HERE
From FDA:

Feline’s Pride Expands Nationwide Recall of its Natural Chicken Formula Cat Food Due to Salmonella Contamination

Contact:
Shelby Gomas,
Tel: 1-716-580-3096

FOR IMMEDIATE RELEASE - July 15, 2010 - Buffalo, NY – Feline’s Pride is expanding its July 1, 2010 voluntary recall of Feline’s Pride Raw food with ground bone for cats and kittens, Natural Chicken Formula, Net Wt. 2.5 lbs. (1.13 kg., 40 oz.) produced on 6/10/10 to include the product produced on 6/21/10, because it may be contaminated with Salmonella. People handling raw pet food can become infected with Salmonella, especially if they have not thoroughly washed their hands after having contact with the raw pet food or any surfaces exposed to the product.

When consumed by humans, Salmonella can cause an infection, salmonellosis. The symptoms of salmonellosis include nausea, vomiting, abdominal cramps, minimal diarrhea, fever, and headache. Certain vulnerable populations, such as children, the elderly, and individuals with compromised immune systems, are particularly susceptible to acquiring salmonellosis from such pet food products and may experience more severe symptoms.

Pets with Salmonella infections may be lethargic and have diarrhea or bloody diarrhea, fever, and vomiting. Some pets will have only decreased appetite, fever and abdominal pain. Infected but otherwise healthy pets can be carriers and infect other animals or humans. If your pet has consumed the recalled product and has these symptoms, please contact your veterinarian.

The product is packaged in uncoded plastic containers and sold frozen to private consumers nationwide. Once thawed, the pet food has a shelf life of about 1 week. The firm manufactures the pet food by an as-ordered basis. This expansion of the recall affects those orders placed and shipped from June 21 through June 26, 2010 (produced on 6/21/10).

The firm and FDA are investigating this matter to determine the source of this problem, and will take any additional steps necessary to protect the public health.

To date, both the firm and the FDA have received no reports of Salmonella infection relating to this product.

People who are experiencing the symptoms of Salmonella infection after having handled the pet food product should seek medical attention, and report their use of the product and illness to the nearest FDA office.

People should thoroughly wash their hands after handling the pet food – especially those made from raw animal protein such as meat or fish -- to help prevent infection. People may risk bacterial infection not only by handling pet foods, but by contact with pets or surfaces exposed to these foods, so it is important that they thoroughly wash their hands with hot water and soap.

Since certain vulnerable populations, such as children, the elderly, and individuals with compromised immune systems, are particularly at risk from exposure they should avoid handling this product.

Consumers with questions should contact the company at (716) 580-3096, Monday -Friday from 10 am - 4 pm EDT.

Cool Animal Sounds: Bald Eagle

To contact us Click HERE
It seems that virtually everyone living in the United States is enamored by the bald eagle. However, it's amazing how few people actually know what our national bird sounds like! It doesn't help that filmmakers have, in the past, dubbed the calls of other raptors over those of the eagles. This is probably because bald eagles, though beautiful to look at, don't exactly sound very impressive. For their size, they have surprisingly quiet calls. I've heard someone say the bald eagle sounds like a squeaky toy, and I must say this description does fit surprisingly well.


Video is from YouTube.com.

Cats don't Prefer Sweets

To contact us Click HERE

Cats taste the world very differently than humans

One thing that I found fascinating during my undergraduate studies was my Modern Biology class. It involved learning about and implementing numerous techniques that are rather new to the field of biology. Thanks to this class, I isolated a number of different cell components, ran various biological molecules through a gel electrophoresis machine, and performed polymerase chain reaction. I also took my own DNA and prepared it for sequencing, which involved refining and isolating the material, cutting out the gene we wanted to look at, then replicating it so that it could be sent off for the actual sequencing process to be performed.

The gene that we looked at was one of the two that go into making the receptors on your tongue that register sweetness. Specifically, the TAS1R2 (taste receptor, type 1, member 2) gene. TAS1R2 must join up with a second protein to signal that sweet flavor. Here is the TAS1R2 gene (specifically, my copy) in its three hundred fifty-five nucleotide entirety: 

GCTGCGTACCACACCCAGCGCCGACCACCACATCGAGGCCATGGTGCAGCTGATGCTGCACTTCCGCTGGAACTGGATCATTGTGCTGGTGAGCAGCGACACCTATGGCCGCGACAATGGCCAGCTGCTTGGCGAGCGCGTGGCCCGGCGCGACATCTGCATCGCCTTCCAGGAGACGCTGCCCACACTGCAGCCCAACCAGAACATGACGTCAGAGGAGCGCCAGCGCCTGGTGACCATTGTGGACAAGCTGCAGCAGAGCACAGCGCGCGTCGTGGTCGTGTTCTCGCCCGACCTGACCCTGTACCACTTCTTCAATGAGGTGCTGCGCCAGAACTTCACTGGCGCCGTGTGG

...not really that interesting.

This is your average TAS1R2 gene for Homo sapiens, nothing special. Just about every human out there has this exact sequence, with few exceptions (one of my classmates, for example, had a single point mutation). However, it is one gene crucial to why humans like sweets so much. This is what the gene looks like after it's been translated into its protein form (the letters are standard for amino acids):

Query  2    LRTTPSADHHIEAMVQLMLHFRWNWIIVLVSSDTYGRDNGQLLGERVARRDICIAFQETL  181            LRTTPSADHHIEAMVQLMLHFRWNWIIVLVSSDTYGRDNGQLLGERVARRDICIAFQETLSbjct  82   LRTTPSADHHIEAMVQLMLHFRWNWIIVLVSSDTYGRDNGQLLGERVARRDICIAFQETL  141Query  182  PTLQPNQNMTSEERQRLVTIVDKLQQSTARVVVVFSPDLTLYHFFNEVLRQNFTGAVW  355            PTLQPNQNMTSEERQRLVTIVDKLQQSTARVVVVFSPDLTLYHFFNEVLRQNFTGAVWSbjct  142  PTLQPNQNMTSEERQRLVTIVDKLQQSTARVVVVFSPDLTLYHFFNEVLRQNFTGAVW  199 

This is a comparison showing my own protein versus the average human. It's a perfect match and codes for a fully functional receptor protein. This gene is seen in a very wide variety of different animals, and the shared genetic material is quite astounding, allowing for countless species to have the ability to taste sweetness.

A cat enjoying a fresh fish

So, why am I talking about humans a post about cats? Well, let's compare the sequence above to the equivalent gene in a cat. The "query"line is the human gene again, and the "sbjct" or subject line is the equivalent gene in Felis silvestris catus.

Query  2    LRTTPSADHHIEAMVQLMLHFRWNWIIVLVSSDTYGRDNGQLLGERVARRDICIAFQETL  181            LRT P+ +H   AM  ++ +FRWNW+  + + D YGR   +   E    RDICI F E +Sbjct  184  LRTIPNDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKFREEAEERDICIDFSELI  243Query  182  PTLQPNQNMTSEERQRLVTIVDKLQQSTARVVVVFSPDLTLYHFFNEVLRQNFTGAVW  355                 +Q    EE Q++V ++   Q STA+V+VVFS    L     E++R+N TG +WSbjct  244  -----SQYSDEEEIQQVVEVI---QNSTAKVIVVFSSGPDLEPLIKEIVRRNITGRIW  293

Cat tongue anatomy

Overall, the genes are fairly similar, but with one major difference. I'm not going to get too complicated with this, but the dashes you see indicate amino acids that are absent in the final protein found in cats but present in humans: a deletion. Changes in a protein don't necessarily result in a change in its functionality, but that deletion is enough to result in the cat's protein being non-functional. Since the protein cannot bond to molecules of sugars or sweeteners, cats simply cannot register the sensation of sweetness. This deletion seems to be unique to the cat family, since other carnivores, such as dogs and bears, have a functioning gene. From what I remember, big cats have this non-functioning gene as well, but it isn't known whether or not the cat allies (such as civets and genets) share this unusual feature.

Though cats aren't able to taste sweetness, this doesn't mean they will avoid it. They are, in fact, completely indifferent to the flavor. So, if your kitty likes something sweet, it's probably going after something other than the sugar. They're quite fond of certain amino acids, so it's possible that's what your kitty enjoys.

Sources Basic Local Alignment Search Tool (BLAST), PLOS Genetics, Journal of Nutrition, and GeneCards. Images are from Wikimedia Commons under Creative Commons licenses: one, two, three.

By the way, BLAST is an amazing tool. Feel free to plug in the ATCG sequence above into their databases to compare the gene for yourself. The programs I used for this post are nucleotide blast and blastx.

Ebon's Mother

To contact us Click HERE
I was finally able to snag a good picture of her for the blog. Most of the pictures I have or can find aren't so great (example). This is Ebon's mother, Hellon, who will be fifteen this Christmas. She has some mobility issues (what dog this age doesn't?), but she's still doing pretty well. I kept miscalculating her age, but I know for sure now. She has the most fascinating graying pattern. I love looking at old dogs and seeing where and when they gray. A lot of them aren't as extensive as this!

Hellon is about sixty pounds and is a retired working dog, retrieving ducks regularly in her younger days. Ebon was the runt from her last litter and ended up being the biggest of them when he finished growing. She was spayed when he was about a year old. She currently lives with a Shih Tzu, but when Ebon was born she had an elderly Pekingese companion. Image is from her owner, used with permission.

 I bet Ebon will look like this one day.

Feline's Pride food recalled due to salmonella

To contact us Click HERE

Feline’s Pride Issues Nationwide Recall of its Natural Chicken Formula Cat Food Due to Salmonella Contamination

Contact:
Shelby Gomas,
Tel: 1-716-580-3096

FOR IMMEDIATE RELEASE - July 1, 2010 - Buffalo, NY – Feline’s Pride is announcing a voluntary recall of Feline’s Pride Raw food with ground bone for cats and kittens, Natural Chicken Formula, Net Wt. 2.5 lbs. (1.13 kg., 40 oz.) produced on 6/10/10, because it may be contaminated with Salmonella. People handling raw pet food can become infected with Salmonella, especially if they have not thoroughly washed their hands after having contact with the raw pet food or any surfaces exposed to the product.

When consumed by humans, Salmonella can cause an infection, salmonellosis. The symptoms of salmonellosis include nausea, vomiting, abdominal cramps, minimal diarrhea, fever, and headache. Certain vulnerable populations, such as children, the elderly, and individuals with compromised immune systems, are particularly susceptible to acquiring salmonellosis from such pet food products and may experience more severe symptoms.

Pets with Salmonella infections may be lethargic and have diarrhea or bloody diarrhea, fever, and vomiting. Some pets will have only decreased appetite, fever and abdominal pain. Infected but otherwise healthy pets can be carriers and infect other animals or humans. If your pet has consumed the recalled product and has these symptoms, please contact your veterinarian.

The product is packaged in uncoded plastic containers and sold frozen to private consumers nationwide. Once thawed, the pet food has a shelf life of about 1 week. The firm manufactures the pet food by an as-ordered basis. This recall affects only those orders placed and shipped from June 10 through June 17, 2010.

The firm and FDA are investigating this matter to determine the source of this problem, and will take any additional steps necessary to protect the public health.

To date, both the firm and the FDA have received no reports of Salmonella infection relating to this product.

This product should not be fed to pets but should instead be disposed of in a safe manner (e.g., in a securely covered trash receptacle). People who are experiencing the symptoms of Salmonella infection after having handled the pet food product should seek medical attention, and report their use of the product and illness to the nearest FDA office.

People should thoroughly wash their hands after handling the pet food – especially those made from raw animal protein such as meat or fish -- to help prevent infection. People may risk bacterial infection not only by handling pet foods, but by contact with pets or surfaces exposed to these foods, so it is important that they thoroughly wash their hands with hot water and soap.

Since certain vulnerable populations, such as children, the elderly, and individuals with compromised immune systems, are particularly at risk from exposure they should avoid handling this product.

Consumers with questions should contact the company at (716) 580-3096, Monday –Friday from 10 am - 4 pm EDT.

Feline's Pride expands food recall due to salmonella

To contact us Click HERE
From FDA:

Feline’s Pride Expands Nationwide Recall of its Natural Chicken Formula Cat Food Due to Salmonella Contamination

Contact:
Shelby Gomas,
Tel: 1-716-580-3096

FOR IMMEDIATE RELEASE - July 15, 2010 - Buffalo, NY – Feline’s Pride is expanding its July 1, 2010 voluntary recall of Feline’s Pride Raw food with ground bone for cats and kittens, Natural Chicken Formula, Net Wt. 2.5 lbs. (1.13 kg., 40 oz.) produced on 6/10/10 to include the product produced on 6/21/10, because it may be contaminated with Salmonella. People handling raw pet food can become infected with Salmonella, especially if they have not thoroughly washed their hands after having contact with the raw pet food or any surfaces exposed to the product.

When consumed by humans, Salmonella can cause an infection, salmonellosis. The symptoms of salmonellosis include nausea, vomiting, abdominal cramps, minimal diarrhea, fever, and headache. Certain vulnerable populations, such as children, the elderly, and individuals with compromised immune systems, are particularly susceptible to acquiring salmonellosis from such pet food products and may experience more severe symptoms.

Pets with Salmonella infections may be lethargic and have diarrhea or bloody diarrhea, fever, and vomiting. Some pets will have only decreased appetite, fever and abdominal pain. Infected but otherwise healthy pets can be carriers and infect other animals or humans. If your pet has consumed the recalled product and has these symptoms, please contact your veterinarian.

The product is packaged in uncoded plastic containers and sold frozen to private consumers nationwide. Once thawed, the pet food has a shelf life of about 1 week. The firm manufactures the pet food by an as-ordered basis. This expansion of the recall affects those orders placed and shipped from June 21 through June 26, 2010 (produced on 6/21/10).

The firm and FDA are investigating this matter to determine the source of this problem, and will take any additional steps necessary to protect the public health.

To date, both the firm and the FDA have received no reports of Salmonella infection relating to this product.

People who are experiencing the symptoms of Salmonella infection after having handled the pet food product should seek medical attention, and report their use of the product and illness to the nearest FDA office.

People should thoroughly wash their hands after handling the pet food – especially those made from raw animal protein such as meat or fish -- to help prevent infection. People may risk bacterial infection not only by handling pet foods, but by contact with pets or surfaces exposed to these foods, so it is important that they thoroughly wash their hands with hot water and soap.

Since certain vulnerable populations, such as children, the elderly, and individuals with compromised immune systems, are particularly at risk from exposure they should avoid handling this product.

Consumers with questions should contact the company at (716) 580-3096, Monday -Friday from 10 am - 4 pm EDT.

)ii EUKANUBA NAT LAMB & RICE PUPPY 15 LB BG »

To contact us Click HERE
Most people are compensating focus to Lamb And Rice Dog Food. The EUKANUBA NAT LAMB & RICE PUPPY 15 LB BG is a product which was trendy from many users. If you are obtaining or discovering this products. We are content to provide you with particulars of EUKANUBA NAT LAMB & RICE PUPPY 15 LB BG purpose of doing your obtain.

EUKANUBA NAT LAMB & RICE PUPPY 15 LB BG

List Price : $36.06
Price : $36.06
Note: This price update on Aug 30, 2012
Check current price Click Here » at Amazon.com

EUKANUBA NAT LAMB & RICE PUPPY 15 LB BG

Product Description

.

• .

See All Buying Option
At Amazon.com

Lamb And Rice Dog Food

Tag: EUKANUBA NAT LAMB & RICE PUPPY 15 LB BG

╠☼∆ Wells PRO PAC Lamb Meal & Rice Formula Dog Food - 6 lb. Bag »

To contact us Click HERE
My friend said to me concerning Lamb And Rice Dog Food and he introduced the merchandise is Wells PRO PAC Lamb Meal & Rice Formula Dog Food - 6 lb. Bag. When I perceive my friends conversation about the features of the product. The following day, I decided to purchase Wells PRO PAC Lamb Meal & Rice Formula Dog Food - 6 lb. Bag. Just after implementing this item, I am highly fulfilled. Characteristic of benefit are since comes after.

Wells PRO PAC Lamb Meal & Rice Formula Dog Food - 6 lb. Bag

List Price : $12.99
Price : $12.99
Note: This price update on September 1, 2012
Check current price Click Here » at Amazon.com

Wells PRO PAC Lamb Meal & Rice Formula Dog Food - 6 lb. Bag

Product Description

PRO PAC Lamb Meal & Rice is designed for dogs who are sensitve to many types of foods.

• Formulated without beef, fish, poultry, corn, wheat or soybeans for allergy sensitive dogs
• Balanced Omega-6 and Omega-3 fatty acids promotes healthy skin and coat
• High quality lamb meal is the first ingredient
• 100% guaranteed

See All Buying Option
At Amazon.com

Lamb And Rice Dog Food

Tag: Wells PRO PAC Lamb Meal & Rice Formula Dog Food - 6 lb. Bag

╦╩ Diamond Naturals Dry Food for Puppy, Small Breed Chicken Formula, 40 Pound Bag »

To contact us Click HERE
Most people are compensating curiosity to Lamb And Rice Dog Food. The Diamond Naturals Dry Food for Puppy, Small Breed Chicken Formula, 40 Pound Bag is a product this was favorite from many people. If you are selecting or uncovering this unit. We are joyful to provide you with information of Diamond Naturals Dry Food for Puppy, Small Breed Chicken Formula, 40 Pound Bag purpose of building your pay for.

Diamond Naturals Dry Food for Puppy, Small Breed Chicken Formula, 40 Pound Bag

List Price : $42.99
Price : $39.76
Note: This price update on September 3, 2012
Check current price Click Here » at Amazon.com

Diamond Naturals Dry Food for Puppy, Small Breed Chicken Formula, 40 Pound Bag

Product Description

Tiny teeth deserve tiny bites packed with nutritious ingredients for optimal growth and development. Diamond Naturals Small Breed Puppy Formula Dry Dog Food contains DHA for optimal development of your puppy's brain and eyes and Omega-6 and Omega-3 fatty acids to keep the skin and coat healthy and shiny.

• Contains DHA for Brain and Eye Development
• Antioxidant Formulation
• Balanced Omega Fatty Acids for Skin and Coat

See All Buying Option
At Amazon.com

Lamb And Rice Dog Food

Tag: Diamond Naturals Dry Food for Puppy, Small Breed Chicken Formula, 40 Pound Bag

▄□● Newman's Own Dog Food, Og, Advanced, 25-Count »

To contact us Click HERE
My buddy reported to me regarding Lamb And Rice Dog Food and he invented the supplement is Newman's Own Dog Food, Og, Advanced, 25-Count. When I listen to my close friends communicate about the benefits of the device. In the morning, I chosen to obtain Newman's Own Dog Food, Og, Advanced, 25-Count. Soon after using this item, I am extremely satisfied. Details of fascination are as follows.

Newman's Own Dog Food, Og, Advanced, 25-Count

List Price : $80.51
Price : $44.61
Note: This price update on October 1, 2012
Check current price Click Here » at Amazon.com

Newman's Own Dog Food, Og, Advanced, 25-Count

Product Description

Newman's Own Advanced Dog Chicken & Rice Formula for Active or Senior Dogs is a unique blend of proteins, whole grains, vitamins and minerals that maximize palatability, digestibility and nutrient assimilation. Feeding your dog high quality, largely organic food is the very best thing you can do for your pet's health.

• A single 25-pound bag
• Unique blend of nutrients to maximize digestibility
• 70% organic

See All Buying Option
At Amazon.com

Lamb And Rice Dog Food

Tag: Newman's Own Dog Food, Og, Advanced, 25-Count

╚≡ Wellness Simple Food Solutions Lamb & Rice - 12 x 12.5 oz »

To contact us Click HERE
Lots of people are spending consideration to Lamb And Rice Dog Food. The Wellness Simple Food Solutions Lamb & Rice - 12 x 12.5 oz is a product that had been trendy from many people. If you are buying or acquiring this products. We are content to provide highlights of Wellness Simple Food Solutions Lamb & Rice - 12 x 12.5 oz purpose of building your pay for.

Wellness Simple Food Solutions Lamb & Rice - 12 x 12.5 oz

List Price : $2.69
Price : $31.04
Note: This price update on October 9, 2012
Check current price Click Here » at Amazon.com

Wellness Simple Food Solutions Lamb & Rice - 12 x 12.5 oz

Product Description

Finally, a simple solution to a difficult problem. Some dogs have allergies, sensitivity and intolerance to commonly used proteins and food additives which can result in gastrointestinal upsets and chronic or recurrent ear infections, hair loss, excessive scratching, hot spots and skin infections. Simple Food Solutions is designed to aid in the nutritional management of these issues, naturally, by removing additional proteins, carbohydrates, fillers and additives to create a hypoallergenic diet. Utilizing our unique 1 + 1 system, we combine one novel animal protein source plus one easily digestible carbohydrate source with a short, yet complete list of key ingredients - and nothing extra. This special, natural recipe limits the number of ingredients your dog is exposed to each day while nourishing simply and completely. Unlike other limited ingredient diets, Simple Food Solutions uses the fewest ingredients possible to deliver complete nutrition. Simple Food Solutions has only 4 main ingredients carefully chosen for their quality, nutritional value and their ability to nourish with simplicity. Oils, vitamins and minerals are added to complete the blend of everything your dog needs for daily wellbeing including antioxidants, omega-3 fatty acids, vitamins and minerals.

• 12/12.5 OZ
• Length: 12
• Width: 9
• Height: 4

See All Buying Option
At Amazon.com

Lamb And Rice Dog Food

Tag: Wellness Simple Food Solutions Lamb & Rice - 12 x 12.5 oz

∆□ Nutro Natural Choice Lite Dog Food »

To contact us Click HERE
Some people are spending focus to Lamb And Rice Dog Food. The Nutro Natural Choice Lite Dog Food is a product that is favorite from the majority purchasers. If you are obtaining or acquiring this products. We are gratified to provide information of Nutro Natural Choice Lite Dog Food purpose of building your acquire.

Nutro Natural Choice Lite Dog Food

List Price : $49.99
Price : $53.34
Note: This price update on October 4, 2012
Check current price Click Here » at Amazon.com

Nutro Natural Choice Lite Dog Food

Product Description

NATURAL CHOICE® Lite Adult Dog Food is formulated to provide 100% complete and balanced nutrition for adult maintenance. Like all NATURAL CHOICE® products, this formula contains no chicken heads, feet or intestines and no ground yellow corn. We use real lamb protein and high levels of linoleic acid for healthy skin and coat, and strong muscles. NATURAL CHOICE® Lite Dog Food provides the premium nutrition your dog deserves for a healthy, happy, and long life.

• The great taste and nutrition of Natural Choice in a reduced fat, reduced calorie formula for overweight, less active dogs
• All natural, rice and lamb formula features glucosamine and chondroitin for healthy joints
• Guaranteed to improve skin and coat

See All Buying Option
At Amazon.com

Lamb And Rice Dog Food

Tag: Nutro Natural Choice Lite Dog Food

╬┬╕ Nutro Natural Choice Small Bites - Lamb & Rice - 17.5 lb »

To contact us Click HERE
My super cool buddy says to me regarding Lamb And Rice Dog Food and he invented the item is Nutro Natural Choice Small Bites - Lamb & Rice - 17.5 lb. When I see my good friends communicate about the benefits of the merchandise. In the morning, I made the decision to shop for Nutro Natural Choice Small Bites - Lamb & Rice - 17.5 lb. After utilizing this merchandise, I am very happy. Aspect of fascination are while comes after.

Nutro Natural Choice Small Bites - Lamb & Rice - 17.5 lb

List Price : $73.44
Price :
Note: This price update on October 5, 2012
Check current price Click Here » at Amazon.com

Nutro Natural Choice Small Bites - Lamb & Rice - 17.5 lb

Product Description

"

Nutro Natural Choice Small Bite - Lamb & Rice

Lamb Meal & Rice Formula Small Bites is formulated to provide 100% complete and balanced nutrition. Like all Natural Choice products, this formula contains no chicken heads, feet or intestines and no ground yellow corn. Instead, it features real lamb protein and high levels of linoleic acid for healthy skin and coat and strong muscles.

Available in 5 lb., 17.5 lb. and 35 lb. bags.

"

• Dogs
• Dog Food
• Dry Food

See All Buying Option
At Amazon.com

Lamb And Rice Dog Food

Tag: Nutro Natural Choice Small Bites - Lamb & Rice - 17.5 lb

∆■■ Tiki Dog Pipeline Luau, Ahi Tuna on Brown Rice (12/2.8oz cans) »

To contact us Click HERE
Plenty of people are spending curiosity to Lamb And Rice Dog Food. The Tiki Dog Pipeline Luau, Ahi Tuna on Brown Rice (12/2.8oz cans) is a product that is preferred from the majority consumers. If you are buying or discovering this device. We are satisfied to give information of Tiki Dog Pipeline Luau, Ahi Tuna on Brown Rice (12/2.8oz cans) purpose of building your acquire.

Tiki Dog Pipeline Luau, Ahi Tuna on Brown Rice (12/2.8oz cans)

List Price :
Price : $20.75
Note: This price update on October 7, 2012
Check current price Click Here » at Amazon.com

Tiki Dog Pipeline Luau, Ahi Tuna on Brown Rice (12/2.8oz cans)

Product Description

Tiki Dog Pipeline Luau Ahi Tuna on Brown Rice Canned Dog Food is manufactured in a human-grade factory and are truly human-grade quality. All products are made with whole meat from preferred, premium portions of seafood that are left whole and intact verses traditional meatloaf or other mystery meat pates. All meat ingredients are called out in the primary flavor names without mystery or unnamed ''ocean fish'', chicken and other inferior filler meat sources.

• Ahi tuna on brown rice with carrots, egg, garlic and kale in tuna consomme
• Certified Dolphin-safe by the International Dolphin Conservation Program
• Manufactured in a human food-grade factory - all fish is hand-cut and filleted
• All ingredients are fresh, whole foods, food-grade raw materials

See All Buying Option
At Amazon.com

Lamb And Rice Dog Food

Tag: Tiki Dog Pipeline Luau, Ahi Tuna on Brown Rice (12/2.8oz cans)

Feline's Pride food recalled due to salmonella

To contact us Click HERE

Feline’s Pride Issues Nationwide Recall of its Natural Chicken Formula Cat Food Due to Salmonella Contamination

Contact:
Shelby Gomas,
Tel: 1-716-580-3096

FOR IMMEDIATE RELEASE - July 1, 2010 - Buffalo, NY – Feline’s Pride is announcing a voluntary recall of Feline’s Pride Raw food with ground bone for cats and kittens, Natural Chicken Formula, Net Wt. 2.5 lbs. (1.13 kg., 40 oz.) produced on 6/10/10, because it may be contaminated with Salmonella. People handling raw pet food can become infected with Salmonella, especially if they have not thoroughly washed their hands after having contact with the raw pet food or any surfaces exposed to the product.

When consumed by humans, Salmonella can cause an infection, salmonellosis. The symptoms of salmonellosis include nausea, vomiting, abdominal cramps, minimal diarrhea, fever, and headache. Certain vulnerable populations, such as children, the elderly, and individuals with compromised immune systems, are particularly susceptible to acquiring salmonellosis from such pet food products and may experience more severe symptoms.

Pets with Salmonella infections may be lethargic and have diarrhea or bloody diarrhea, fever, and vomiting. Some pets will have only decreased appetite, fever and abdominal pain. Infected but otherwise healthy pets can be carriers and infect other animals or humans. If your pet has consumed the recalled product and has these symptoms, please contact your veterinarian.

The product is packaged in uncoded plastic containers and sold frozen to private consumers nationwide. Once thawed, the pet food has a shelf life of about 1 week. The firm manufactures the pet food by an as-ordered basis. This recall affects only those orders placed and shipped from June 10 through June 17, 2010.

The firm and FDA are investigating this matter to determine the source of this problem, and will take any additional steps necessary to protect the public health.

To date, both the firm and the FDA have received no reports of Salmonella infection relating to this product.

This product should not be fed to pets but should instead be disposed of in a safe manner (e.g., in a securely covered trash receptacle). People who are experiencing the symptoms of Salmonella infection after having handled the pet food product should seek medical attention, and report their use of the product and illness to the nearest FDA office.

People should thoroughly wash their hands after handling the pet food – especially those made from raw animal protein such as meat or fish -- to help prevent infection. People may risk bacterial infection not only by handling pet foods, but by contact with pets or surfaces exposed to these foods, so it is important that they thoroughly wash their hands with hot water and soap.

Since certain vulnerable populations, such as children, the elderly, and individuals with compromised immune systems, are particularly at risk from exposure they should avoid handling this product.

Consumers with questions should contact the company at (716) 580-3096, Monday –Friday from 10 am - 4 pm EDT.

Feline's Pride expands food recall due to salmonella

To contact us Click HERE
From FDA:

Feline’s Pride Expands Nationwide Recall of its Natural Chicken Formula Cat Food Due to Salmonella Contamination

Contact:
Shelby Gomas,
Tel: 1-716-580-3096

FOR IMMEDIATE RELEASE - July 15, 2010 - Buffalo, NY – Feline’s Pride is expanding its July 1, 2010 voluntary recall of Feline’s Pride Raw food with ground bone for cats and kittens, Natural Chicken Formula, Net Wt. 2.5 lbs. (1.13 kg., 40 oz.) produced on 6/10/10 to include the product produced on 6/21/10, because it may be contaminated with Salmonella. People handling raw pet food can become infected with Salmonella, especially if they have not thoroughly washed their hands after having contact with the raw pet food or any surfaces exposed to the product.

When consumed by humans, Salmonella can cause an infection, salmonellosis. The symptoms of salmonellosis include nausea, vomiting, abdominal cramps, minimal diarrhea, fever, and headache. Certain vulnerable populations, such as children, the elderly, and individuals with compromised immune systems, are particularly susceptible to acquiring salmonellosis from such pet food products and may experience more severe symptoms.

Pets with Salmonella infections may be lethargic and have diarrhea or bloody diarrhea, fever, and vomiting. Some pets will have only decreased appetite, fever and abdominal pain. Infected but otherwise healthy pets can be carriers and infect other animals or humans. If your pet has consumed the recalled product and has these symptoms, please contact your veterinarian.

The product is packaged in uncoded plastic containers and sold frozen to private consumers nationwide. Once thawed, the pet food has a shelf life of about 1 week. The firm manufactures the pet food by an as-ordered basis. This expansion of the recall affects those orders placed and shipped from June 21 through June 26, 2010 (produced on 6/21/10).

The firm and FDA are investigating this matter to determine the source of this problem, and will take any additional steps necessary to protect the public health.

To date, both the firm and the FDA have received no reports of Salmonella infection relating to this product.

People who are experiencing the symptoms of Salmonella infection after having handled the pet food product should seek medical attention, and report their use of the product and illness to the nearest FDA office.

People should thoroughly wash their hands after handling the pet food – especially those made from raw animal protein such as meat or fish -- to help prevent infection. People may risk bacterial infection not only by handling pet foods, but by contact with pets or surfaces exposed to these foods, so it is important that they thoroughly wash their hands with hot water and soap.

Since certain vulnerable populations, such as children, the elderly, and individuals with compromised immune systems, are particularly at risk from exposure they should avoid handling this product.

Consumers with questions should contact the company at (716) 580-3096, Monday -Friday from 10 am - 4 pm EDT.

Guess the Genotype #84

To contact us Click HERE
Can you guess this litter of puppies' genotypes? Their breed?

Image is from Wikimedia Commons under a Creative Commons license

These puppies are Bedlington terriers, a breed that is born dark, but will fade with age. Due to this, he breed looks quite different when all grown up. So, what are these puppies' genotypes?

All of the puppies are dominant black. Though tan points are possible in the breed, none of these pups have those markings. However, it's still possible that some of them may be carriers for tan point. Since there isn't any other form of the Agouti locus seen in the breed, it's like the breed is fixed atat tan pointed. Despite this, most dogs also have at least one copy of the dominant black gene, which hides the tan points. Since these puppies are all dominant black, they are either KK dominant black or Kk dominant black (carrying non-black). The reason for the color change from puppy to adult is thanks to the graying gene. Though the gene has not been mapped on the canine genome, it has been confirmed via breeding data and is believed to be dominant. Since Bedlington terriers all fade with age, the gene must be fixed in the breed, making all Bedlingtons GG gray.

Lastly, there is one brown puppy, a color caused by the recessive liver gene. Since there is only one puppy of this color, I suspect that both of the parents for the litter carried brown. Due to this, there are probably carriers and non-carriers for the liver gene in the litter. So, the brown puppy is bb liver and the black puppies are either Bb non-liver (carrying liver) or BB non-liver.

So, that's atat BB/Bb/bb GG KK/Kk or graying black and graying liver.

Cats don't Prefer Sweets

To contact us Click HERE

Cats taste the world very differently than humans

One thing that I found fascinating during my undergraduate studies was my Modern Biology class. It involved learning about and implementing numerous techniques that are rather new to the field of biology. Thanks to this class, I isolated a number of different cell components, ran various biological molecules through a gel electrophoresis machine, and performed polymerase chain reaction. I also took my own DNA and prepared it for sequencing, which involved refining and isolating the material, cutting out the gene we wanted to look at, then replicating it so that it could be sent off for the actual sequencing process to be performed.

The gene that we looked at was one of the two that go into making the receptors on your tongue that register sweetness. Specifically, the TAS1R2 (taste receptor, type 1, member 2) gene. TAS1R2 must join up with a second protein to signal that sweet flavor. Here is the TAS1R2 gene (specifically, my copy) in its three hundred fifty-five nucleotide entirety: 

GCTGCGTACCACACCCAGCGCCGACCACCACATCGAGGCCATGGTGCAGCTGATGCTGCACTTCCGCTGGAACTGGATCATTGTGCTGGTGAGCAGCGACACCTATGGCCGCGACAATGGCCAGCTGCTTGGCGAGCGCGTGGCCCGGCGCGACATCTGCATCGCCTTCCAGGAGACGCTGCCCACACTGCAGCCCAACCAGAACATGACGTCAGAGGAGCGCCAGCGCCTGGTGACCATTGTGGACAAGCTGCAGCAGAGCACAGCGCGCGTCGTGGTCGTGTTCTCGCCCGACCTGACCCTGTACCACTTCTTCAATGAGGTGCTGCGCCAGAACTTCACTGGCGCCGTGTGG

...not really that interesting.

This is your average TAS1R2 gene for Homo sapiens, nothing special. Just about every human out there has this exact sequence, with few exceptions (one of my classmates, for example, had a single point mutation). However, it is one gene crucial to why humans like sweets so much. This is what the gene looks like after it's been translated into its protein form (the letters are standard for amino acids):

Query  2    LRTTPSADHHIEAMVQLMLHFRWNWIIVLVSSDTYGRDNGQLLGERVARRDICIAFQETL  181            LRTTPSADHHIEAMVQLMLHFRWNWIIVLVSSDTYGRDNGQLLGERVARRDICIAFQETLSbjct  82   LRTTPSADHHIEAMVQLMLHFRWNWIIVLVSSDTYGRDNGQLLGERVARRDICIAFQETL  141Query  182  PTLQPNQNMTSEERQRLVTIVDKLQQSTARVVVVFSPDLTLYHFFNEVLRQNFTGAVW  355            PTLQPNQNMTSEERQRLVTIVDKLQQSTARVVVVFSPDLTLYHFFNEVLRQNFTGAVWSbjct  142  PTLQPNQNMTSEERQRLVTIVDKLQQSTARVVVVFSPDLTLYHFFNEVLRQNFTGAVW  199 

This is a comparison showing my own protein versus the average human. It's a perfect match and codes for a fully functional receptor protein. This gene is seen in a very wide variety of different animals, and the shared genetic material is quite astounding, allowing for countless species to have the ability to taste sweetness.

A cat enjoying a fresh fish

So, why am I talking about humans a post about cats? Well, let's compare the sequence above to the equivalent gene in a cat. The "query"line is the human gene again, and the "sbjct" or subject line is the equivalent gene in Felis silvestris catus.

Query  2    LRTTPSADHHIEAMVQLMLHFRWNWIIVLVSSDTYGRDNGQLLGERVARRDICIAFQETL  181            LRT P+ +H   AM  ++ +FRWNW+  + + D YGR   +   E    RDICI F E +Sbjct  184  LRTIPNDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKFREEAEERDICIDFSELI  243Query  182  PTLQPNQNMTSEERQRLVTIVDKLQQSTARVVVVFSPDLTLYHFFNEVLRQNFTGAVW  355                 +Q    EE Q++V ++   Q STA+V+VVFS    L     E++R+N TG +WSbjct  244  -----SQYSDEEEIQQVVEVI---QNSTAKVIVVFSSGPDLEPLIKEIVRRNITGRIW  293

Cat tongue anatomy

Overall, the genes are fairly similar, but with one major difference. I'm not going to get too complicated with this, but the dashes you see indicate amino acids that are absent in the final protein found in cats but present in humans: a deletion. Changes in a protein don't necessarily result in a change in its functionality, but that deletion is enough to result in the cat's protein being non-functional. Since the protein cannot bond to molecules of sugars or sweeteners, cats simply cannot register the sensation of sweetness. This deletion seems to be unique to the cat family, since other carnivores, such as dogs and bears, have a functioning gene. From what I remember, big cats have this non-functioning gene as well, but it isn't known whether or not the cat allies (such as civets and genets) share this unusual feature.

Though cats aren't able to taste sweetness, this doesn't mean they will avoid it. They are, in fact, completely indifferent to the flavor. So, if your kitty likes something sweet, it's probably going after something other than the sugar. They're quite fond of certain amino acids, so it's possible that's what your kitty enjoys.

Sources Basic Local Alignment Search Tool (BLAST), PLOS Genetics, Journal of Nutrition, and GeneCards. Images are from Wikimedia Commons under Creative Commons licenses: one, two, three.

By the way, BLAST is an amazing tool. Feel free to plug in the ATCG sequence above into their databases to compare the gene for yourself. The programs I used for this post are nucleotide blast and blastx.

Ebon's Mother

To contact us Click HERE
I was finally able to snag a good picture of her for the blog. Most of the pictures I have or can find aren't so great (example). This is Ebon's mother, Hellon, who will be fifteen this Christmas. She has some mobility issues (what dog this age doesn't?), but she's still doing pretty well. I kept miscalculating her age, but I know for sure now. She has the most fascinating graying pattern. I love looking at old dogs and seeing where and when they gray. A lot of them aren't as extensive as this!

Hellon is about sixty pounds and is a retired working dog, retrieving ducks regularly in her younger days. Ebon was the runt from her last litter and ended up being the biggest of them when he finished growing. She was spayed when he was about a year old. She currently lives with a Shih Tzu, but when Ebon was born she had an elderly Pekingese companion. Image is from her owner, used with permission.

 I bet Ebon will look like this one day.

Feline's Pride food recalled due to salmonella

To contact us Click HERE

Feline’s Pride Issues Nationwide Recall of its Natural Chicken Formula Cat Food Due to Salmonella Contamination

Contact:
Shelby Gomas,
Tel: 1-716-580-3096

FOR IMMEDIATE RELEASE - July 1, 2010 - Buffalo, NY – Feline’s Pride is announcing a voluntary recall of Feline’s Pride Raw food with ground bone for cats and kittens, Natural Chicken Formula, Net Wt. 2.5 lbs. (1.13 kg., 40 oz.) produced on 6/10/10, because it may be contaminated with Salmonella. People handling raw pet food can become infected with Salmonella, especially if they have not thoroughly washed their hands after having contact with the raw pet food or any surfaces exposed to the product.

When consumed by humans, Salmonella can cause an infection, salmonellosis. The symptoms of salmonellosis include nausea, vomiting, abdominal cramps, minimal diarrhea, fever, and headache. Certain vulnerable populations, such as children, the elderly, and individuals with compromised immune systems, are particularly susceptible to acquiring salmonellosis from such pet food products and may experience more severe symptoms.

Pets with Salmonella infections may be lethargic and have diarrhea or bloody diarrhea, fever, and vomiting. Some pets will have only decreased appetite, fever and abdominal pain. Infected but otherwise healthy pets can be carriers and infect other animals or humans. If your pet has consumed the recalled product and has these symptoms, please contact your veterinarian.

The product is packaged in uncoded plastic containers and sold frozen to private consumers nationwide. Once thawed, the pet food has a shelf life of about 1 week. The firm manufactures the pet food by an as-ordered basis. This recall affects only those orders placed and shipped from June 10 through June 17, 2010.

The firm and FDA are investigating this matter to determine the source of this problem, and will take any additional steps necessary to protect the public health.

To date, both the firm and the FDA have received no reports of Salmonella infection relating to this product.

This product should not be fed to pets but should instead be disposed of in a safe manner (e.g., in a securely covered trash receptacle). People who are experiencing the symptoms of Salmonella infection after having handled the pet food product should seek medical attention, and report their use of the product and illness to the nearest FDA office.

People should thoroughly wash their hands after handling the pet food – especially those made from raw animal protein such as meat or fish -- to help prevent infection. People may risk bacterial infection not only by handling pet foods, but by contact with pets or surfaces exposed to these foods, so it is important that they thoroughly wash their hands with hot water and soap.

Since certain vulnerable populations, such as children, the elderly, and individuals with compromised immune systems, are particularly at risk from exposure they should avoid handling this product.

Consumers with questions should contact the company at (716) 580-3096, Monday –Friday from 10 am - 4 pm EDT.

Feline's Pride expands food recall due to salmonella

To contact us Click HERE
From FDA:

Feline’s Pride Expands Nationwide Recall of its Natural Chicken Formula Cat Food Due to Salmonella Contamination

Contact:
Shelby Gomas,
Tel: 1-716-580-3096

FOR IMMEDIATE RELEASE - July 15, 2010 - Buffalo, NY – Feline’s Pride is expanding its July 1, 2010 voluntary recall of Feline’s Pride Raw food with ground bone for cats and kittens, Natural Chicken Formula, Net Wt. 2.5 lbs. (1.13 kg., 40 oz.) produced on 6/10/10 to include the product produced on 6/21/10, because it may be contaminated with Salmonella. People handling raw pet food can become infected with Salmonella, especially if they have not thoroughly washed their hands after having contact with the raw pet food or any surfaces exposed to the product.

When consumed by humans, Salmonella can cause an infection, salmonellosis. The symptoms of salmonellosis include nausea, vomiting, abdominal cramps, minimal diarrhea, fever, and headache. Certain vulnerable populations, such as children, the elderly, and individuals with compromised immune systems, are particularly susceptible to acquiring salmonellosis from such pet food products and may experience more severe symptoms.

Pets with Salmonella infections may be lethargic and have diarrhea or bloody diarrhea, fever, and vomiting. Some pets will have only decreased appetite, fever and abdominal pain. Infected but otherwise healthy pets can be carriers and infect other animals or humans. If your pet has consumed the recalled product and has these symptoms, please contact your veterinarian.

The product is packaged in uncoded plastic containers and sold frozen to private consumers nationwide. Once thawed, the pet food has a shelf life of about 1 week. The firm manufactures the pet food by an as-ordered basis. This expansion of the recall affects those orders placed and shipped from June 21 through June 26, 2010 (produced on 6/21/10).

The firm and FDA are investigating this matter to determine the source of this problem, and will take any additional steps necessary to protect the public health.

To date, both the firm and the FDA have received no reports of Salmonella infection relating to this product.

People who are experiencing the symptoms of Salmonella infection after having handled the pet food product should seek medical attention, and report their use of the product and illness to the nearest FDA office.

People should thoroughly wash their hands after handling the pet food – especially those made from raw animal protein such as meat or fish -- to help prevent infection. People may risk bacterial infection not only by handling pet foods, but by contact with pets or surfaces exposed to these foods, so it is important that they thoroughly wash their hands with hot water and soap.

Since certain vulnerable populations, such as children, the elderly, and individuals with compromised immune systems, are particularly at risk from exposure they should avoid handling this product.

Consumers with questions should contact the company at (716) 580-3096, Monday -Friday from 10 am - 4 pm EDT.

Dog Food Review: Innova

To contact us Click HERE

This is the eighth of the dog food review series I'm doing. The formula of this food is changing, so this review will be obsolete once the old formula is no longer being sold.

I forgot to take pictures again, so no photos this time.

Innova Adult Dry Dog Food - Large Bites
Dog Food Advisor rating: ★★★★☆
This food is AAFCO approved for all life stages.

Ingredients: Turkey, Chicken, Chicken Meal, Barley, Brown Rice, Potato, Rice, Chicken Fat (Preserved with Mixed Tocopherols a Source of Vitamin E), Flaxseed, Natural Flavors, Herring, Apple, Carrot, Pumpkin, Egg, Sunflower Oil, Sea Salt, Potassium Chloride, Herring Oil, Cottage Cheese, Alfalfa Sprouts, Vitamins (Betaine Hydrochloride, Vitamin A Supplement, Niacin Supplement, Calcium Pantothenate, Beta Carotene, Vitamin B12 Supplement, Vitamin D3 Supplement, Riboflavin Supplement, Pyridoxine Hydrochloride, Thiamine Mononitrate, Biotin, Folic Acid), Minerals (Zinc Proteinate, Iron Proteinate, Copper Proteinate, Manganese Proteinate, Calcium Iodate), Direct Fed Microbials (Dried Enterococcus faecium, Dried Lactobacillus acidophilus, Dried Lactobacilus casei), Lecithin Rosemary Extract 

Items in italics will be discussed later. 

Bag's recommended daily feeding for a dog 80 lbs: 2 3/4 cups
Crude Protein: minimum of 24.0%
Crude Fat: minimum of 14.0%
Crude Fiber: maximum of 2.5%
Moisture: maximum of 10.0%
Calorie content: 504 kcal/cup, 3,694 kcal/kg
Calculated amount to maintain Ebon's ideal weight (82.5 lbs): 3.31 cups or 0.45 kg (0.99 lbs)
 - Innova has its own calculator, which advises 3.125 cups/day
Price per pound when buying the largest bag (30 lbs at $49.99): $1.6663
Estimated cost of feeding Ebon per year on this food: $602.12 (12.045 of the 30 lb bags)
Ebon receives slightly less than the calculated feeding amount to allow for his daily treats
Ebon's overall health on this food: Very good. Shiny coat, poop consistent, energy level moderate to high.



I started transitioning from Ebon's old food on July 2nd, and I started transitioning him off of this food three days ago. The kibble itself is nice and big and triangular in shape. The smell is typically for a food with its sort of formula: a moderately meaty smell. The meat content of this food is significant, considering the fact that the first three ingredients are meats. Some nice things to see in this food: chelated minerals and probiotics. Chelated minerals are believed to be more easily absorbed and used by the body than non-chelated minerals, and probiotics/microorganisms help maintain good gut flora to provide for better digestion.

I would have to say Ebon's experiences with this food were, well, average. There's nothing really remarkable to report, either good or bad. He was pretty typical, everything doing fine. As I mentioned above, his energy level was typical for him, as were his coat and stool consistency. There were no bad traits that I noticed when he was on foods that were of poorer quality or that he didn't respond well to. He gained a bit of weight on this food, but I think that's mostly due to him sneaking some food from the other animals. Siggy and my brother's cats are messy eaters, and Ebon is definitely an opportunistic eater if given the chance. Siggy tends to grab a mouthful and chew with at least a kibble or two falling out of his mouth each time he does so. Ebon will actually stop eating his own food to pick up the dropped kibble, then go back to eating his own food. He got bold enough from doing this that he tried to take Siggy's peanut butter-laced Kong one day, which ended up with a growl that sent Ebon scurrying from the room. He's been respectful ever since, but is still a kibble thief if I don't watch him.

As those who have read these reviews before know, Ebon's stools become soft when he's stressed. It seems like his stress poops were softer than average on this food, but it may seem that way partly due to him being more stressed than average during this trial. Siggy's been visiting and his whines and barks when he's needy seem to stress Ebon out. He's a quiet dog himself and we live rather quiet lives, so any sort of unusually loud atmosphere is unsettling to him if he's not used to it. Luckily, he seems to be getting used to it as his stress behaviors, including the stress poops, were basically gone after about a week. Progress is always good. Ironically, though Ebon seems to find Siggy boisterous, Ebon is by far the more rambunctious of the two dogs. He just isn't very vocal, besides barking at the doorbell.

Will I change foods? We'll see. Next up: California Natural.

More on the Dogs (and other things)

To contact us Click HERE

The boys politely eating together

Things have been a little hectic lately with me caring for all of the animals. Mainly it stems from the various quirks they all have, including feeding seemingly all of them on different schedules and the like. There are other reasons it's been difficult, but this blog isn't about me.

Anyway, I wanted to make a note about Ebon's food trials. I was bad and picked up some more food today: Go! Natural Grain Free. It was half off because the formula is being discontinued and I just couldn't help myself. It's dated sooner than the other foods I have, so it will be next in line to be reviewed. The bag is also only six pounds, so this will be sort of a mini review.

I've also been trying out a number of canned foods, which eventually will be lumped into one mega review later. One of the main reasons for this is I picked up a lot of cans because the same place that had the kibble mentioned above on sale is also no longer going to be selling certain brands of canned food. It's hard for me to pass up a sale.

For now, I'll end with a picture of Siggy trying to sleep in Ebon's kennel.

He just doesn't fit