31 Aralık 2012 Pazartesi

Z1 Evanger's Super Premium For Dogs Lamb and Rice Dinner, 12-Pack »

To contact us Click HERE
Plenty of people are spending recognition to Lamb And Rice Dog Food. The Evanger's Super Premium For Dogs Lamb and Rice Dinner, 12-Pack is a product this was famous from the majority buyers. If you are buying or uncovering this item. We are joyful to provide you with particulars of Evanger's Super Premium For Dogs Lamb and Rice Dinner, 12-Pack purpose of building your order.

Evanger's Super Premium For Dogs Lamb and Rice Dinner, 12-Pack




More image Evanger's Super Premium For Dogs Lamb and Rice Dinner, 12-Pack
List Price : $17.10
Price : $19.40
Note: This price update on November 19, 2012
Check current price Click Here » at Amazon.com

Evanger's Super Premium For Dogs Lamb and Rice Dinner, 12-Pack


Product Description

A Gold Label Meal for Your Best Friend

Good health has been stamped with gold. The Evangers Gold Label formula contains all natural beef and whole dressed chicken combined with beef liver for palatability and health benefits. This delicious meal comes in 3 flavors -- Beef and Chicken, Chicken Thighs and Lamb and Rice. Beef and Chicken and Lamb and Rice are available in 12 x 13.2-oz. cans while the Whole Chicken Thighs is available in 12 x 12-oz. cans.

Evangers Gold Label:

  • Contains beef
  • Promotes good health
  • Great to taste
  • 167 Kcals/100G

Treat your best friend to a delicious, healthy meal -- after all, nothing but the best will do.

A Closer Look: With a minimum of 10% crude protein and a maximum of 1.5% fiber, the Evangers Gold Label dog food packs in a great combination of good health and taste. Certified Kosher.

Made Specially for: Dogs of all ages. The Whole Chicken Thighs is not recommended for small dogs as it contains bones.

Free of: Grains

  • Complete dinner
  • Kosher


See All Buying Option
At Amazon.com

Lamb And Rice Dog Food


Tag: Evanger's Super Premium For Dogs Lamb and Rice Dinner, 12-Pack

Good Prairie Puppy Chicken Meal & Brown Rice Medley by Nature's Variety, 30-Pound Bag

To contact us Click HERE
My billy confab to me about Prairie Puppy Chicken Meal & Brown Rice Medley by Nature's Variety, 30-Pound Bag and he hand the device is Prairie Puppy Chicken Meal & Brown Rice Medley by Nature's Variety, 30-Pound Bag. When I learn my confidant inform about the particulars of the product. In the morning, I choose to dispend Prairie Puppy Chicken Meal & Brown Rice Medley by Nature's Variety, 30-Pound Bag. Right posterior using this product, I am considerably congenial. Details of interest are figure beneath.

Prairie Puppy Chicken Meal & Brown Rice Medley by Nature's Variety, 30-Pound Bag


More Prairie Puppy Chicken Meal & Brown Rice Medley by Nature's Variety, 30-Pound Bag
List Price : $70.00
Price : $50.99
Note: This price update on (December 23, 2012)
Check current price Click Here to Amazon



Prairie Puppy Chicken Meal & Brown Rice Medley by Nature's Variety, 30-Pound Bag


  • No fillers, no corn, no wheat, no soy - proven to provide great taste and nutrition
  • Our formulas are carefully balanced to provide nutritious protein for proper muscle development, and have enhanced levels of DHA for optimal brain nourishment
  • All natural with essential vitamins and minerals
  • Prairie products are designed so you can feed multiple varieties in cans and kibble
  • Made in the USA


See Today Price
on amazon


Post Tags: Cheap Prairie Puppy Chicken Meal & Brown Rice Medley by Nature's Variety, 30-Pound Bag
$ Prairie Puppy Chicken Meal & Brown Rice Medley by Nature's Variety, 30-Pound Bag

See Purina Pro Plan Dry Puppy Food, Chicken and Rice Formula, 6-Pound Bag

To contact us Click HERE
My billy pass to me respecting Purina Pro Plan Dry Puppy Food, Chicken and Rice Formula, 6-Pound Bag and he invest the capability is Purina Pro Plan Dry Puppy Food, Chicken and Rice Formula, 6-Pound Bag. When I realize my friend convey about the specs of the goods. In the daylight, I choose to pay out Purina Pro Plan Dry Puppy Food, Chicken and Rice Formula, 6-Pound Bag. Right subsequent using this product, I am sorely congenial. Details of attention are display beneath.

Purina Pro Plan Dry Puppy Food, Chicken and Rice Formula, 6-Pound Bag


More Purina Pro Plan Dry Puppy Food, Chicken and Rice Formula, 6-Pound Bag
List Price : $22.48
Price : $15.99
Note: This price update on (Dec 28, 2012)
Check current price Click Here on Amazon


Product Description

Pro Plan Chicken & Rice Puppy food is specially formulated to bolster the key protective systems while supplying the nutritional needs of a growing puppy. The key protective systems of puppies - the immune system, digestive system and skin & coat systems - are just developing during the formative first year or two of life. These systems are the natural way your puppy protects himself, and they need complete nutrition containing protein and an assortment of nutrients to help them grow healthy and strong.

Amazon.com

From the moment we wake up each morning, to the instant we pull into our driveways at the end of each day – our dogs are there, offering the one-of-a-kind commitment only they can provide.

That’s why we want to do more to give back to our dogs in every way we can.

Pro Plan® Puppy Chicken & Rice Formula is a dry food that has been specially formulated to meet the nutritional needs of developing puppies. The Puppy Chicken & Rice Formula from Pro Plan® is made with real chicken as the #1 ingredient, as well as OptiStart® easy-to-digest, natural milk proteins to help support your puppy’s developing immune system.

Pro Plan® Puppy Chicken & Rice Formula Supports:
Brain and Vision DevelopmentWith DHA, an omega-3 fatty acid, also found in mothers’ milk.
Healthy Heart With high-quality protein along with essential vitamins and minerals.
Strong Immune SystemWith complete nutrition with high levels of antioxidants and quality protein, including real chicken.
Healthy Digestive SystemWith a highly digestible formula that includes wholesome rice and easy-to-digest natural milk proteins.
Radiant Skin and CoatWith vitamin A and high-quality protein combined with linoleic acid, an omega-6 fatty acid.
Strong Teeth and BonesWith calcium, phosphorus, and other minerals--as well as a hard kibble texture that helps reduce plaque build-up on teeth.
Optimal WeightWith the appropriate protein to fat ratio to help maintain ideal body condition.
Exceptional FlavorWith high-quality ingredients, beginning with real chicken, as the #1 ingredient.
About Pro Plan® from Purina®
Passionate pet owners strive to do more for their dogs and cats in any way they can. That’s why Pro Plan® has created a complete line of dog and cat food made with high-quality ingredients for outstanding nutrition and taste, in a variety of formulas to help meet your pet’s unique needs based on life stage, lifestyle, and breed size.


Purina Pro Plan Dry Puppy Food, Chicken and Rice Formula, 6-Pound Bag


  • One 6-pound bag of Pro Plan® Puppy Chicken & Rice Formula dry dog food
  • Made with real chicken as the #1 ingredient
  • High levels of antioxidants for overall health and wellness
  • OptiStart®, easy-to-digest, natural milk proteins to help support a puppy's developing immune system
  • Specially formulated to meet the nutritional needs of puppies


See Today Price
on amazon


Item Tags: Cheap Purina Pro Plan Dry Puppy Food, Chicken and Rice Formula, 6-Pound Bag
♪ Purina Pro Plan Dry Puppy Food, Chicken and Rice Formula, 6-Pound Bag

Feline's Pride food recalled due to salmonella

To contact us Click HERE

Feline’s Pride Issues Nationwide Recall of its Natural Chicken Formula Cat Food Due to Salmonella Contamination

Contact:
Shelby Gomas,
Tel: 1-716-580-3096

FOR IMMEDIATE RELEASE - July 1, 2010 - Buffalo, NY – Feline’s Pride is announcing a voluntary recall of Feline’s Pride Raw food with ground bone for cats and kittens, Natural Chicken Formula, Net Wt. 2.5 lbs. (1.13 kg., 40 oz.) produced on 6/10/10, because it may be contaminated with Salmonella. People handling raw pet food can become infected with Salmonella, especially if they have not thoroughly washed their hands after having contact with the raw pet food or any surfaces exposed to the product.

When consumed by humans, Salmonella can cause an infection, salmonellosis. The symptoms of salmonellosis include nausea, vomiting, abdominal cramps, minimal diarrhea, fever, and headache. Certain vulnerable populations, such as children, the elderly, and individuals with compromised immune systems, are particularly susceptible to acquiring salmonellosis from such pet food products and may experience more severe symptoms.

Pets with Salmonella infections may be lethargic and have diarrhea or bloody diarrhea, fever, and vomiting. Some pets will have only decreased appetite, fever and abdominal pain. Infected but otherwise healthy pets can be carriers and infect other animals or humans. If your pet has consumed the recalled product and has these symptoms, please contact your veterinarian.

The product is packaged in uncoded plastic containers and sold frozen to private consumers nationwide. Once thawed, the pet food has a shelf life of about 1 week. The firm manufactures the pet food by an as-ordered basis. This recall affects only those orders placed and shipped from June 10 through June 17, 2010.

The firm and FDA are investigating this matter to determine the source of this problem, and will take any additional steps necessary to protect the public health.

To date, both the firm and the FDA have received no reports of Salmonella infection relating to this product.

This product should not be fed to pets but should instead be disposed of in a safe manner (e.g., in a securely covered trash receptacle). People who are experiencing the symptoms of Salmonella infection after having handled the pet food product should seek medical attention, and report their use of the product and illness to the nearest FDA office.

People should thoroughly wash their hands after handling the pet food – especially those made from raw animal protein such as meat or fish -- to help prevent infection. People may risk bacterial infection not only by handling pet foods, but by contact with pets or surfaces exposed to these foods, so it is important that they thoroughly wash their hands with hot water and soap.

Since certain vulnerable populations, such as children, the elderly, and individuals with compromised immune systems, are particularly at risk from exposure they should avoid handling this product.

Consumers with questions should contact the company at (716) 580-3096, Monday –Friday from 10 am - 4 pm EDT.

Feline's Pride expands food recall due to salmonella

To contact us Click HERE
From FDA:

Feline’s Pride Expands Nationwide Recall of its Natural Chicken Formula Cat Food Due to Salmonella Contamination

Contact:
Shelby Gomas,
Tel: 1-716-580-3096

FOR IMMEDIATE RELEASE - July 15, 2010 - Buffalo, NY – Feline’s Pride is expanding its July 1, 2010 voluntary recall of Feline’s Pride Raw food with ground bone for cats and kittens, Natural Chicken Formula, Net Wt. 2.5 lbs. (1.13 kg., 40 oz.) produced on 6/10/10 to include the product produced on 6/21/10, because it may be contaminated with Salmonella. People handling raw pet food can become infected with Salmonella, especially if they have not thoroughly washed their hands after having contact with the raw pet food or any surfaces exposed to the product.

When consumed by humans, Salmonella can cause an infection, salmonellosis. The symptoms of salmonellosis include nausea, vomiting, abdominal cramps, minimal diarrhea, fever, and headache. Certain vulnerable populations, such as children, the elderly, and individuals with compromised immune systems, are particularly susceptible to acquiring salmonellosis from such pet food products and may experience more severe symptoms.

Pets with Salmonella infections may be lethargic and have diarrhea or bloody diarrhea, fever, and vomiting. Some pets will have only decreased appetite, fever and abdominal pain. Infected but otherwise healthy pets can be carriers and infect other animals or humans. If your pet has consumed the recalled product and has these symptoms, please contact your veterinarian.

The product is packaged in uncoded plastic containers and sold frozen to private consumers nationwide. Once thawed, the pet food has a shelf life of about 1 week. The firm manufactures the pet food by an as-ordered basis. This expansion of the recall affects those orders placed and shipped from June 21 through June 26, 2010 (produced on 6/21/10).

The firm and FDA are investigating this matter to determine the source of this problem, and will take any additional steps necessary to protect the public health.

To date, both the firm and the FDA have received no reports of Salmonella infection relating to this product.

People who are experiencing the symptoms of Salmonella infection after having handled the pet food product should seek medical attention, and report their use of the product and illness to the nearest FDA office.

People should thoroughly wash their hands after handling the pet food – especially those made from raw animal protein such as meat or fish -- to help prevent infection. People may risk bacterial infection not only by handling pet foods, but by contact with pets or surfaces exposed to these foods, so it is important that they thoroughly wash their hands with hot water and soap.

Since certain vulnerable populations, such as children, the elderly, and individuals with compromised immune systems, are particularly at risk from exposure they should avoid handling this product.

Consumers with questions should contact the company at (716) 580-3096, Monday -Friday from 10 am - 4 pm EDT.

27 Aralık 2012 Perşembe

┌┤ Hill's Science Diet Ideal Balance Adult Chicken and Brown Rice Dinner Dry Dog Food Bag, 4-Pound »

To contact us Click HERE
Mate said to me concerning Lamb And Rice Dog Food and he invented the solution is Hill's Science Diet Ideal Balance Adult Chicken and Brown Rice Dinner Dry Dog Food Bag, 4-Pound. When I perceive my close friends talk about the functions of the product. In the morning, I made a decision to purchase Hill's Science Diet Ideal Balance Adult Chicken and Brown Rice Dinner Dry Dog Food Bag, 4-Pound. Right after utilizing this device, I am really pleased. Aspect of appeal are since follows.

Hill's Science Diet Ideal Balance Adult Chicken and Brown Rice Dinner Dry Dog Food Bag, 4-Pound




More image Hill's Science Diet Ideal Balance Adult Chicken and Brown Rice Dinner Dry Dog Food Bag, 4-Pound
List Price : $16.05
Price : $9.99
Note: This price update on November 3, 2012
Check current price Click Here » at Amazon.com

Hill's Science Diet Ideal Balance Adult Chicken and Brown Rice Dinner Dry Dog Food Bag, 4-Pound


Product Description

Ideal Balance™ is a combination of natural ingredients and the power of advanced nutrition to create a pet food that provides the best of nature and the best of nutrition in one balanced package. For adult cats, Ideal Balance™ has fresh chicken as the 1st ingredient, fruits & vegetables including cranberries, and no corn or artificial colors

Amazon.com Product Description


Ideal Balance™ Dog Food

Ideal Balance™ Dog Food:

Choose natural ingredients in perfect balance
     Fresh chicken 1st ingredient
     No corn
     Formulated for easy digestion
     Optimal levels of key nutrients
     Available in Grain-Freet


  • Overall Health & Vitality
  • Healthy Digestive System
  • Healthy Immune Function
  • Healthy Skin and Radiant Coat
  • Lean Muscle and Ideal Body Weight


See All Buying Option
At Amazon.com

Lamb And Rice Dog Food


Tag: Hill's Science Diet Ideal Balance Adult Chicken and Brown Rice Dinner Dry Dog Food Bag, 4-Pound

Z1 Evanger's Super Premium For Dogs Lamb and Rice Dinner, 12-Pack »

To contact us Click HERE
Plenty of people are spending recognition to Lamb And Rice Dog Food. The Evanger's Super Premium For Dogs Lamb and Rice Dinner, 12-Pack is a product this was famous from the majority buyers. If you are buying or uncovering this item. We are joyful to provide you with particulars of Evanger's Super Premium For Dogs Lamb and Rice Dinner, 12-Pack purpose of building your order.

Evanger's Super Premium For Dogs Lamb and Rice Dinner, 12-Pack




More image Evanger's Super Premium For Dogs Lamb and Rice Dinner, 12-Pack
List Price : $17.10
Price : $19.40
Note: This price update on November 19, 2012
Check current price Click Here » at Amazon.com

Evanger's Super Premium For Dogs Lamb and Rice Dinner, 12-Pack


Product Description

A Gold Label Meal for Your Best Friend

Good health has been stamped with gold. The Evangers Gold Label formula contains all natural beef and whole dressed chicken combined with beef liver for palatability and health benefits. This delicious meal comes in 3 flavors -- Beef and Chicken, Chicken Thighs and Lamb and Rice. Beef and Chicken and Lamb and Rice are available in 12 x 13.2-oz. cans while the Whole Chicken Thighs is available in 12 x 12-oz. cans.

Evangers Gold Label:

  • Contains beef
  • Promotes good health
  • Great to taste
  • 167 Kcals/100G

Treat your best friend to a delicious, healthy meal -- after all, nothing but the best will do.

A Closer Look: With a minimum of 10% crude protein and a maximum of 1.5% fiber, the Evangers Gold Label dog food packs in a great combination of good health and taste. Certified Kosher.

Made Specially for: Dogs of all ages. The Whole Chicken Thighs is not recommended for small dogs as it contains bones.

Free of: Grains

  • Complete dinner
  • Kosher


See All Buying Option
At Amazon.com

Lamb And Rice Dog Food


Tag: Evanger's Super Premium For Dogs Lamb and Rice Dinner, 12-Pack

About VeRUS Chicken and Brown Rice Formula Canned Dog Food

To contact us Click HERE
My partisan remark to me regarding VeRUS Chicken and Brown Rice Formula Canned Dog Food and he consign the competence is VeRUS Chicken and Brown Rice Formula Canned Dog Food. When I hear my confidant inform about the particulars of the goods. In the forenoon, I determine to spend VeRUS Chicken and Brown Rice Formula Canned Dog Food. Right subsequent using this merchandise, I am considerably enjoyable. Details of regard are appear underfoot.

VeRUS Chicken and Brown Rice Formula Canned Dog Food


Pic VeRUS Chicken and Brown Rice Formula Canned Dog Food
List Price :
Price :
Note: This price update on (Dec 19, 2012)
Check current price Click Here to Amazon



VeRUS Chicken and Brown Rice Formula Canned Dog Food


  • 12/13.2-oz cans


See Today Price
on amazon


Item Tags: New prices VeRUS Chicken and Brown Rice Formula Canned Dog Food
♪ VeRUS Chicken and Brown Rice Formula Canned Dog Food

Good Prairie Puppy Chicken Meal & Brown Rice Medley by Nature's Variety, 30-Pound Bag

To contact us Click HERE
My billy confab to me about Prairie Puppy Chicken Meal & Brown Rice Medley by Nature's Variety, 30-Pound Bag and he hand the device is Prairie Puppy Chicken Meal & Brown Rice Medley by Nature's Variety, 30-Pound Bag. When I learn my confidant inform about the particulars of the product. In the morning, I choose to dispend Prairie Puppy Chicken Meal & Brown Rice Medley by Nature's Variety, 30-Pound Bag. Right posterior using this product, I am considerably congenial. Details of interest are figure beneath.

Prairie Puppy Chicken Meal & Brown Rice Medley by Nature's Variety, 30-Pound Bag


More Prairie Puppy Chicken Meal & Brown Rice Medley by Nature's Variety, 30-Pound Bag
List Price : $70.00
Price : $50.99
Note: This price update on (December 23, 2012)
Check current price Click Here to Amazon



Prairie Puppy Chicken Meal & Brown Rice Medley by Nature's Variety, 30-Pound Bag


  • No fillers, no corn, no wheat, no soy - proven to provide great taste and nutrition
  • Our formulas are carefully balanced to provide nutritious protein for proper muscle development, and have enhanced levels of DHA for optimal brain nourishment
  • All natural with essential vitamins and minerals
  • Prairie products are designed so you can feed multiple varieties in cans and kibble
  • Made in the USA


See Today Price
on amazon


Post Tags: Cheap Prairie Puppy Chicken Meal & Brown Rice Medley by Nature's Variety, 30-Pound Bag
$ Prairie Puppy Chicken Meal & Brown Rice Medley by Nature's Variety, 30-Pound Bag

New AvoDerm Natural Dog Food - Lamb & Rice - 12x13 oz

To contact us Click HERE
My buddy converse to me concerning AvoDerm Natural Dog Food - Lamb & Rice - 12x13 oz and he counsel the device is AvoDerm Natural Dog Food - Lamb & Rice - 12x13 oz. When I grasp my comrade convey about the ins and outs of the goods. In the early morning, I resolve to buy AvoDerm Natural Dog Food - Lamb & Rice - 12x13 oz. Right posterior using this good, I am greatly pleased. Details of regard are show underfoot.

AvoDerm Natural Dog Food - Lamb & Rice - 12x13 oz


More AvoDerm Natural Dog Food - Lamb & Rice - 12x13 oz
List Price :
Price : $22.79
Note: This price update on (December 24, 2012)
Check current price Click Here to Amazon



AvoDerm Natural Dog Food - Lamb & Rice - 12x13 oz


  • Gluten Free
  • Natural or Organic Ingredients
  • Wheat Free


See Today Price
At Amazon


Post Tags: Cheap AvoDerm Natural Dog Food - Lamb & Rice - 12x13 oz
@ AvoDerm Natural Dog Food - Lamb & Rice - 12x13 oz

20 Aralık 2012 Perşembe

Cats don't Prefer Sweets

To contact us Click HERE
Cats taste the world very differently than humans

One thing that I found fascinating during my undergraduate studies was my Modern Biology class. It involved learning about and implementing numerous techniques that are rather new to the field of biology. Thanks to this class, I isolated a number of different cell components, ran various biological molecules through a gel electrophoresis machine, and performed polymerase chain reaction. I also took my own DNA and prepared it for sequencing, which involved refining and isolating the material, cutting out the gene we wanted to look at, then replicating it so that it could be sent off for the actual sequencing process to be performed.

The gene that we looked at was one of the two that go into making the receptors on your tongue that register sweetness. Specifically, the TAS1R2 (taste receptor, type 1, member 2) gene. TAS1R2 must join up with a second protein to signal that sweet flavor. Here is the TAS1R2 gene (specifically, my copy) in its three hundred fifty-five nucleotide entirety: 
GCTGCGTACCACACCCAGCGCCGACCACCACATCGAGGCCATGGTGCAGCTGATGCTGCACTTCCGCTGGAACTGGATCATTGTGCTGGTGAGCAGCGACACCTATGGCCGCGACAATGGCCAGCTGCTTGGCGAGCGCGTGGCCCGGCGCGACATCTGCATCGCCTTCCAGGAGACGCTGCCCACACTGCAGCCCAACCAGAACATGACGTCAGAGGAGCGCCAGCGCCTGGTGACCATTGTGGACAAGCTGCAGCAGAGCACAGCGCGCGTCGTGGTCGTGTTCTCGCCCGACCTGACCCTGTACCACTTCTTCAATGAGGTGCTGCGCCAGAACTTCACTGGCGCCGTGTGG
...not really that interesting.

This is your average TAS1R2 gene for Homo sapiens, nothing special. Just about every human out there has this exact sequence, with few exceptions (one of my classmates, for example, had a single point mutation). However, it is one gene crucial to why humans like sweets so much. This is what the gene looks like after it's been translated into its protein form (the letters are standard for amino acids):
Query  2    LRTTPSADHHIEAMVQLMLHFRWNWIIVLVSSDTYGRDNGQLLGERVARRDICIAFQETL  181            LRTTPSADHHIEAMVQLMLHFRWNWIIVLVSSDTYGRDNGQLLGERVARRDICIAFQETLSbjct  82   LRTTPSADHHIEAMVQLMLHFRWNWIIVLVSSDTYGRDNGQLLGERVARRDICIAFQETL  141Query  182  PTLQPNQNMTSEERQRLVTIVDKLQQSTARVVVVFSPDLTLYHFFNEVLRQNFTGAVW  355            PTLQPNQNMTSEERQRLVTIVDKLQQSTARVVVVFSPDLTLYHFFNEVLRQNFTGAVWSbjct  142  PTLQPNQNMTSEERQRLVTIVDKLQQSTARVVVVFSPDLTLYHFFNEVLRQNFTGAVW  199 
This is a comparison showing my own protein versus the average human. It's a perfect match and codes for a fully functional receptor protein. This gene is seen in a very wide variety of different animals, and the shared genetic material is quite astounding, allowing for countless species to have the ability to taste sweetness.

A cat enjoying a fresh fish

So, why am I talking about humans a post about cats? Well, let's compare the sequence above to the equivalent gene in a cat. The "query"line is the human gene again, and the "sbjct" or subject line is the equivalent gene in Felis silvestris catus.
Query  2    LRTTPSADHHIEAMVQLMLHFRWNWIIVLVSSDTYGRDNGQLLGERVARRDICIAFQETL  181            LRT P+ +H   AM  ++ +FRWNW+  + + D YGR   +   E    RDICI F E +Sbjct  184  LRTIPNDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKFREEAEERDICIDFSELI  243Query  182  PTLQPNQNMTSEERQRLVTIVDKLQQSTARVVVVFSPDLTLYHFFNEVLRQNFTGAVW  355                 +Q    EE Q++V ++   Q STA+V+VVFS    L     E++R+N TG +WSbjct  244  -----SQYSDEEEIQQVVEVI---QNSTAKVIVVFSSGPDLEPLIKEIVRRNITGRIW  293
Cat tongue anatomy
Overall, the genes are fairly similar, but with one major difference. I'm not going to get too complicated with this, but the dashes you see indicate amino acids that are absent in the final protein found in cats but present in humans: a deletion. Changes in a protein don't necessarily result in a change in its functionality, but that deletion is enough to result in the cat's protein being non-functional. Since the protein cannot bond to molecules of sugars or sweeteners, cats simply cannot register the sensation of sweetness. This deletion seems to be unique to the cat family, since other carnivores, such as dogs and bears, have a functioning gene. From what I remember, big cats have this non-functioning gene as well, but it isn't known whether or not the cat allies (such as civets and genets) share this unusual feature.

Though cats aren't able to taste sweetness, this doesn't mean they will avoid it. They are, in fact, completely indifferent to the flavor. So, if your kitty likes something sweet, it's probably going after something other than the sugar. They're quite fond of certain amino acids, so it's possible that's what your kitty enjoys.

Sources Basic Local Alignment Search Tool (BLAST), PLOS Genetics, Journal of Nutrition, and GeneCards. Images are from Wikimedia Commons under Creative Commons licenses: one, two, three.

By the way, BLAST is an amazing tool. Feel free to plug in the ATCG sequence above into their databases to compare the gene for yourself. The programs I used for this post are nucleotide blast and blastx.

Ebon's Mother

To contact us Click HERE
I was finally able to snag a good picture of her for the blog. Most of the pictures I have or can find aren't so great (example). This is Ebon's mother, Hellon, who will be fifteen this Christmas. She has some mobility issues (what dog this age doesn't?), but she's still doing pretty well. I kept miscalculating her age, but I know for sure now. She has the most fascinating graying pattern. I love looking at old dogs and seeing where and when they gray. A lot of them aren't as extensive as this!

Hellon is about sixty pounds and is a retired working dog, retrieving ducks regularly in her younger days. Ebon was the runt from her last litter and ended up being the biggest of them when he finished growing. She was spayed when he was about a year old. She currently lives with a Shih Tzu, but when Ebon was born she had an elderly Pekingese companion. Image is from her owner, used with permission.
 I bet Ebon will look like this one day.

What I've Been Up To

To contact us Click HERE
Obligatory picture of dog being cute
I've been preparing for and taking the GRE.

When I first started this blog I was still intending to go through with my decision to become a high school teacher. One of my main reasons for wanting to do this was that I thought our country needed more well-qualified teachers. My own high school Biology teacher was terrible and made many of my classmates hate the subject, but my senior Zoology teacher (yes, my high school offered it) was amazing. She made me want to be like her. I got into a post-baccalaureate program, began taking courses, and even took the GACE (Georgia Assessment for the Certification of Educators). I did well. I thought it was even kind of fun. Then, I actually got into a classroom full of high school freshmen to observe and realized I hated it. The kids were impossible. It actually depressed me. So, I pulled myself out of the program.

Now, I'm working on applying to PhD programs. My hope is to get a PhD in genetics. I had some apprehension about the teaching program even before I applied to it, but the concept of me going into genetics research is just plain exciting. It's going to be challenging, sure, and I'm going to have to move far away from everyone I know, but that's okay.

I'm hoping to get some new blog posts up quite soon.

Feline's Pride food recalled due to salmonella

To contact us Click HERE

Feline’s Pride Issues Nationwide Recall of its Natural Chicken Formula Cat Food Due to Salmonella Contamination

Contact:
Shelby Gomas,
Tel: 1-716-580-3096

FOR IMMEDIATE RELEASE - July 1, 2010 - Buffalo, NY – Feline’s Pride is announcing a voluntary recall of Feline’s Pride Raw food with ground bone for cats and kittens, Natural Chicken Formula, Net Wt. 2.5 lbs. (1.13 kg., 40 oz.) produced on 6/10/10, because it may be contaminated with Salmonella. People handling raw pet food can become infected with Salmonella, especially if they have not thoroughly washed their hands after having contact with the raw pet food or any surfaces exposed to the product.

When consumed by humans, Salmonella can cause an infection, salmonellosis. The symptoms of salmonellosis include nausea, vomiting, abdominal cramps, minimal diarrhea, fever, and headache. Certain vulnerable populations, such as children, the elderly, and individuals with compromised immune systems, are particularly susceptible to acquiring salmonellosis from such pet food products and may experience more severe symptoms.

Pets with Salmonella infections may be lethargic and have diarrhea or bloody diarrhea, fever, and vomiting. Some pets will have only decreased appetite, fever and abdominal pain. Infected but otherwise healthy pets can be carriers and infect other animals or humans. If your pet has consumed the recalled product and has these symptoms, please contact your veterinarian.

The product is packaged in uncoded plastic containers and sold frozen to private consumers nationwide. Once thawed, the pet food has a shelf life of about 1 week. The firm manufactures the pet food by an as-ordered basis. This recall affects only those orders placed and shipped from June 10 through June 17, 2010.

The firm and FDA are investigating this matter to determine the source of this problem, and will take any additional steps necessary to protect the public health.

To date, both the firm and the FDA have received no reports of Salmonella infection relating to this product.

This product should not be fed to pets but should instead be disposed of in a safe manner (e.g., in a securely covered trash receptacle). People who are experiencing the symptoms of Salmonella infection after having handled the pet food product should seek medical attention, and report their use of the product and illness to the nearest FDA office.

People should thoroughly wash their hands after handling the pet food – especially those made from raw animal protein such as meat or fish -- to help prevent infection. People may risk bacterial infection not only by handling pet foods, but by contact with pets or surfaces exposed to these foods, so it is important that they thoroughly wash their hands with hot water and soap.

Since certain vulnerable populations, such as children, the elderly, and individuals with compromised immune systems, are particularly at risk from exposure they should avoid handling this product.

Consumers with questions should contact the company at (716) 580-3096, Monday –Friday from 10 am - 4 pm EDT.

Feline's Pride expands food recall due to salmonella

To contact us Click HERE
From FDA:

Feline’s Pride Expands Nationwide Recall of its Natural Chicken Formula Cat Food Due to Salmonella Contamination

Contact:
Shelby Gomas,
Tel: 1-716-580-3096

FOR IMMEDIATE RELEASE - July 15, 2010 - Buffalo, NY – Feline’s Pride is expanding its July 1, 2010 voluntary recall of Feline’s Pride Raw food with ground bone for cats and kittens, Natural Chicken Formula, Net Wt. 2.5 lbs. (1.13 kg., 40 oz.) produced on 6/10/10 to include the product produced on 6/21/10, because it may be contaminated with Salmonella. People handling raw pet food can become infected with Salmonella, especially if they have not thoroughly washed their hands after having contact with the raw pet food or any surfaces exposed to the product.

When consumed by humans, Salmonella can cause an infection, salmonellosis. The symptoms of salmonellosis include nausea, vomiting, abdominal cramps, minimal diarrhea, fever, and headache. Certain vulnerable populations, such as children, the elderly, and individuals with compromised immune systems, are particularly susceptible to acquiring salmonellosis from such pet food products and may experience more severe symptoms.

Pets with Salmonella infections may be lethargic and have diarrhea or bloody diarrhea, fever, and vomiting. Some pets will have only decreased appetite, fever and abdominal pain. Infected but otherwise healthy pets can be carriers and infect other animals or humans. If your pet has consumed the recalled product and has these symptoms, please contact your veterinarian.

The product is packaged in uncoded plastic containers and sold frozen to private consumers nationwide. Once thawed, the pet food has a shelf life of about 1 week. The firm manufactures the pet food by an as-ordered basis. This expansion of the recall affects those orders placed and shipped from June 21 through June 26, 2010 (produced on 6/21/10).

The firm and FDA are investigating this matter to determine the source of this problem, and will take any additional steps necessary to protect the public health.

To date, both the firm and the FDA have received no reports of Salmonella infection relating to this product.

People who are experiencing the symptoms of Salmonella infection after having handled the pet food product should seek medical attention, and report their use of the product and illness to the nearest FDA office.

People should thoroughly wash their hands after handling the pet food – especially those made from raw animal protein such as meat or fish -- to help prevent infection. People may risk bacterial infection not only by handling pet foods, but by contact with pets or surfaces exposed to these foods, so it is important that they thoroughly wash their hands with hot water and soap.

Since certain vulnerable populations, such as children, the elderly, and individuals with compromised immune systems, are particularly at risk from exposure they should avoid handling this product.

Consumers with questions should contact the company at (716) 580-3096, Monday -Friday from 10 am - 4 pm EDT.

16 Aralık 2012 Pazar

┌┤ Hill's Science Diet Ideal Balance Adult Chicken and Brown Rice Dinner Dry Dog Food Bag, 4-Pound »

To contact us Click HERE
Mate said to me concerning Lamb And Rice Dog Food and he invented the solution is Hill's Science Diet Ideal Balance Adult Chicken and Brown Rice Dinner Dry Dog Food Bag, 4-Pound. When I perceive my close friends talk about the functions of the product. In the morning, I made a decision to purchase Hill's Science Diet Ideal Balance Adult Chicken and Brown Rice Dinner Dry Dog Food Bag, 4-Pound. Right after utilizing this device, I am really pleased. Aspect of appeal are since follows.

Hill's Science Diet Ideal Balance Adult Chicken and Brown Rice Dinner Dry Dog Food Bag, 4-Pound




More image Hill's Science Diet Ideal Balance Adult Chicken and Brown Rice Dinner Dry Dog Food Bag, 4-Pound
List Price : $16.05
Price : $9.99
Note: This price update on November 3, 2012
Check current price Click Here » at Amazon.com

Hill's Science Diet Ideal Balance Adult Chicken and Brown Rice Dinner Dry Dog Food Bag, 4-Pound


Product Description

Ideal Balance™ is a combination of natural ingredients and the power of advanced nutrition to create a pet food that provides the best of nature and the best of nutrition in one balanced package. For adult cats, Ideal Balance™ has fresh chicken as the 1st ingredient, fruits & vegetables including cranberries, and no corn or artificial colors

Amazon.com Product Description


Ideal Balance™ Dog Food

Ideal Balance™ Dog Food:

Choose natural ingredients in perfect balance
     Fresh chicken 1st ingredient
     No corn
     Formulated for easy digestion
     Optimal levels of key nutrients
     Available in Grain-Freet


  • Overall Health & Vitality
  • Healthy Digestive System
  • Healthy Immune Function
  • Healthy Skin and Radiant Coat
  • Lean Muscle and Ideal Body Weight


See All Buying Option
At Amazon.com

Lamb And Rice Dog Food


Tag: Hill's Science Diet Ideal Balance Adult Chicken and Brown Rice Dinner Dry Dog Food Bag, 4-Pound

Z1 Evanger's Super Premium For Dogs Lamb and Rice Dinner, 12-Pack »

To contact us Click HERE
Plenty of people are spending recognition to Lamb And Rice Dog Food. The Evanger's Super Premium For Dogs Lamb and Rice Dinner, 12-Pack is a product this was famous from the majority buyers. If you are buying or uncovering this item. We are joyful to provide you with particulars of Evanger's Super Premium For Dogs Lamb and Rice Dinner, 12-Pack purpose of building your order.

Evanger's Super Premium For Dogs Lamb and Rice Dinner, 12-Pack




More image Evanger's Super Premium For Dogs Lamb and Rice Dinner, 12-Pack
List Price : $17.10
Price : $19.40
Note: This price update on November 19, 2012
Check current price Click Here » at Amazon.com

Evanger's Super Premium For Dogs Lamb and Rice Dinner, 12-Pack


Product Description

A Gold Label Meal for Your Best Friend

Good health has been stamped with gold. The Evangers Gold Label formula contains all natural beef and whole dressed chicken combined with beef liver for palatability and health benefits. This delicious meal comes in 3 flavors -- Beef and Chicken, Chicken Thighs and Lamb and Rice. Beef and Chicken and Lamb and Rice are available in 12 x 13.2-oz. cans while the Whole Chicken Thighs is available in 12 x 12-oz. cans.

Evangers Gold Label:

  • Contains beef
  • Promotes good health
  • Great to taste
  • 167 Kcals/100G

Treat your best friend to a delicious, healthy meal -- after all, nothing but the best will do.

A Closer Look: With a minimum of 10% crude protein and a maximum of 1.5% fiber, the Evangers Gold Label dog food packs in a great combination of good health and taste. Certified Kosher.

Made Specially for: Dogs of all ages. The Whole Chicken Thighs is not recommended for small dogs as it contains bones.

Free of: Grains

  • Complete dinner
  • Kosher


See All Buying Option
At Amazon.com

Lamb And Rice Dog Food


Tag: Evanger's Super Premium For Dogs Lamb and Rice Dinner, 12-Pack

Cool Iams Simple and Natural Chicken, Rice and Barley Recipe, 25-Pounds

To contact us Click HERE
Cheap Iams Simple and Natural Chicken, Rice and Barley Recipe, 25-Pounds At the present time I see attractive selling price of this item on amazon. But I'm not certain This value will adjust in the future or not.





Good Iams Simple and Natural Chicken, Rice and Barley Recipe, 25-Pounds

List Price: $47.98

Price:

Note: This price update on

Click here for check current price at amazon

  • No artificial preservatives, colors or flavors.
  • #1 ingredient is real chicken for strong lean muscles.
  • High level of the antioxidant vitamin E for a strong immune system.
  • Optimal level of omega 6 and 3 fatty acids work on the inside for skin and coat health.
  • FOS Prebiotic and beet pulp, to naturally promote digestive health and a natural fiber blend for nutrient absorption.
  • 100% complete and balanced nutrition for adult dogs.
  • Contains no corn, wheat or soy.

♪ When you try this product, you will be satisfied Iams Simple and Natural Chicken, Rice and Barley Recipe, 25-Pounds. I think this is good product.


See Buying Option and More Details

At amazon.com


Post Tag: Iams Simple and Natural Chicken, Rice and Barley Recipe, 25-Pounds

Feline's Pride food recalled due to salmonella

To contact us Click HERE

Feline’s Pride Issues Nationwide Recall of its Natural Chicken Formula Cat Food Due to Salmonella Contamination

Contact:
Shelby Gomas,
Tel: 1-716-580-3096

FOR IMMEDIATE RELEASE - July 1, 2010 - Buffalo, NY – Feline’s Pride is announcing a voluntary recall of Feline’s Pride Raw food with ground bone for cats and kittens, Natural Chicken Formula, Net Wt. 2.5 lbs. (1.13 kg., 40 oz.) produced on 6/10/10, because it may be contaminated with Salmonella. People handling raw pet food can become infected with Salmonella, especially if they have not thoroughly washed their hands after having contact with the raw pet food or any surfaces exposed to the product.

When consumed by humans, Salmonella can cause an infection, salmonellosis. The symptoms of salmonellosis include nausea, vomiting, abdominal cramps, minimal diarrhea, fever, and headache. Certain vulnerable populations, such as children, the elderly, and individuals with compromised immune systems, are particularly susceptible to acquiring salmonellosis from such pet food products and may experience more severe symptoms.

Pets with Salmonella infections may be lethargic and have diarrhea or bloody diarrhea, fever, and vomiting. Some pets will have only decreased appetite, fever and abdominal pain. Infected but otherwise healthy pets can be carriers and infect other animals or humans. If your pet has consumed the recalled product and has these symptoms, please contact your veterinarian.

The product is packaged in uncoded plastic containers and sold frozen to private consumers nationwide. Once thawed, the pet food has a shelf life of about 1 week. The firm manufactures the pet food by an as-ordered basis. This recall affects only those orders placed and shipped from June 10 through June 17, 2010.

The firm and FDA are investigating this matter to determine the source of this problem, and will take any additional steps necessary to protect the public health.

To date, both the firm and the FDA have received no reports of Salmonella infection relating to this product.

This product should not be fed to pets but should instead be disposed of in a safe manner (e.g., in a securely covered trash receptacle). People who are experiencing the symptoms of Salmonella infection after having handled the pet food product should seek medical attention, and report their use of the product and illness to the nearest FDA office.

People should thoroughly wash their hands after handling the pet food – especially those made from raw animal protein such as meat or fish -- to help prevent infection. People may risk bacterial infection not only by handling pet foods, but by contact with pets or surfaces exposed to these foods, so it is important that they thoroughly wash their hands with hot water and soap.

Since certain vulnerable populations, such as children, the elderly, and individuals with compromised immune systems, are particularly at risk from exposure they should avoid handling this product.

Consumers with questions should contact the company at (716) 580-3096, Monday –Friday from 10 am - 4 pm EDT.

Feline's Pride expands food recall due to salmonella

To contact us Click HERE
From FDA:

Feline’s Pride Expands Nationwide Recall of its Natural Chicken Formula Cat Food Due to Salmonella Contamination

Contact:
Shelby Gomas,
Tel: 1-716-580-3096

FOR IMMEDIATE RELEASE - July 15, 2010 - Buffalo, NY – Feline’s Pride is expanding its July 1, 2010 voluntary recall of Feline’s Pride Raw food with ground bone for cats and kittens, Natural Chicken Formula, Net Wt. 2.5 lbs. (1.13 kg., 40 oz.) produced on 6/10/10 to include the product produced on 6/21/10, because it may be contaminated with Salmonella. People handling raw pet food can become infected with Salmonella, especially if they have not thoroughly washed their hands after having contact with the raw pet food or any surfaces exposed to the product.

When consumed by humans, Salmonella can cause an infection, salmonellosis. The symptoms of salmonellosis include nausea, vomiting, abdominal cramps, minimal diarrhea, fever, and headache. Certain vulnerable populations, such as children, the elderly, and individuals with compromised immune systems, are particularly susceptible to acquiring salmonellosis from such pet food products and may experience more severe symptoms.

Pets with Salmonella infections may be lethargic and have diarrhea or bloody diarrhea, fever, and vomiting. Some pets will have only decreased appetite, fever and abdominal pain. Infected but otherwise healthy pets can be carriers and infect other animals or humans. If your pet has consumed the recalled product and has these symptoms, please contact your veterinarian.

The product is packaged in uncoded plastic containers and sold frozen to private consumers nationwide. Once thawed, the pet food has a shelf life of about 1 week. The firm manufactures the pet food by an as-ordered basis. This expansion of the recall affects those orders placed and shipped from June 21 through June 26, 2010 (produced on 6/21/10).

The firm and FDA are investigating this matter to determine the source of this problem, and will take any additional steps necessary to protect the public health.

To date, both the firm and the FDA have received no reports of Salmonella infection relating to this product.

People who are experiencing the symptoms of Salmonella infection after having handled the pet food product should seek medical attention, and report their use of the product and illness to the nearest FDA office.

People should thoroughly wash their hands after handling the pet food – especially those made from raw animal protein such as meat or fish -- to help prevent infection. People may risk bacterial infection not only by handling pet foods, but by contact with pets or surfaces exposed to these foods, so it is important that they thoroughly wash their hands with hot water and soap.

Since certain vulnerable populations, such as children, the elderly, and individuals with compromised immune systems, are particularly at risk from exposure they should avoid handling this product.

Consumers with questions should contact the company at (716) 580-3096, Monday -Friday from 10 am - 4 pm EDT.

12 Aralık 2012 Çarşamba

Cats don't Prefer Sweets

To contact us Click HERE
Cats taste the world very differently than humans

One thing that I found fascinating during my undergraduate studies was my Modern Biology class. It involved learning about and implementing numerous techniques that are rather new to the field of biology. Thanks to this class, I isolated a number of different cell components, ran various biological molecules through a gel electrophoresis machine, and performed polymerase chain reaction. I also took my own DNA and prepared it for sequencing, which involved refining and isolating the material, cutting out the gene we wanted to look at, then replicating it so that it could be sent off for the actual sequencing process to be performed.

The gene that we looked at was one of the two that go into making the receptors on your tongue that register sweetness. Specifically, the TAS1R2 (taste receptor, type 1, member 2) gene. TAS1R2 must join up with a second protein to signal that sweet flavor. Here is the TAS1R2 gene (specifically, my copy) in its three hundred fifty-five nucleotide entirety: 
GCTGCGTACCACACCCAGCGCCGACCACCACATCGAGGCCATGGTGCAGCTGATGCTGCACTTCCGCTGGAACTGGATCATTGTGCTGGTGAGCAGCGACACCTATGGCCGCGACAATGGCCAGCTGCTTGGCGAGCGCGTGGCCCGGCGCGACATCTGCATCGCCTTCCAGGAGACGCTGCCCACACTGCAGCCCAACCAGAACATGACGTCAGAGGAGCGCCAGCGCCTGGTGACCATTGTGGACAAGCTGCAGCAGAGCACAGCGCGCGTCGTGGTCGTGTTCTCGCCCGACCTGACCCTGTACCACTTCTTCAATGAGGTGCTGCGCCAGAACTTCACTGGCGCCGTGTGG
...not really that interesting.

This is your average TAS1R2 gene for Homo sapiens, nothing special. Just about every human out there has this exact sequence, with few exceptions (one of my classmates, for example, had a single point mutation). However, it is one gene crucial to why humans like sweets so much. This is what the gene looks like after it's been translated into its protein form (the letters are standard for amino acids):
Query  2    LRTTPSADHHIEAMVQLMLHFRWNWIIVLVSSDTYGRDNGQLLGERVARRDICIAFQETL  181            LRTTPSADHHIEAMVQLMLHFRWNWIIVLVSSDTYGRDNGQLLGERVARRDICIAFQETLSbjct  82   LRTTPSADHHIEAMVQLMLHFRWNWIIVLVSSDTYGRDNGQLLGERVARRDICIAFQETL  141Query  182  PTLQPNQNMTSEERQRLVTIVDKLQQSTARVVVVFSPDLTLYHFFNEVLRQNFTGAVW  355            PTLQPNQNMTSEERQRLVTIVDKLQQSTARVVVVFSPDLTLYHFFNEVLRQNFTGAVWSbjct  142  PTLQPNQNMTSEERQRLVTIVDKLQQSTARVVVVFSPDLTLYHFFNEVLRQNFTGAVW  199 
This is a comparison showing my own protein versus the average human. It's a perfect match and codes for a fully functional receptor protein. This gene is seen in a very wide variety of different animals, and the shared genetic material is quite astounding, allowing for countless species to have the ability to taste sweetness.

A cat enjoying a fresh fish

So, why am I talking about humans a post about cats? Well, let's compare the sequence above to the equivalent gene in a cat. The "query"line is the human gene again, and the "sbjct" or subject line is the equivalent gene in Felis silvestris catus.
Query  2    LRTTPSADHHIEAMVQLMLHFRWNWIIVLVSSDTYGRDNGQLLGERVARRDICIAFQETL  181            LRT P+ +H   AM  ++ +FRWNW+  + + D YGR   +   E    RDICI F E +Sbjct  184  LRTIPNDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKFREEAEERDICIDFSELI  243Query  182  PTLQPNQNMTSEERQRLVTIVDKLQQSTARVVVVFSPDLTLYHFFNEVLRQNFTGAVW  355                 +Q    EE Q++V ++   Q STA+V+VVFS    L     E++R+N TG +WSbjct  244  -----SQYSDEEEIQQVVEVI---QNSTAKVIVVFSSGPDLEPLIKEIVRRNITGRIW  293
Cat tongue anatomy
Overall, the genes are fairly similar, but with one major difference. I'm not going to get too complicated with this, but the dashes you see indicate amino acids that are absent in the final protein found in cats but present in humans: a deletion. Changes in a protein don't necessarily result in a change in its functionality, but that deletion is enough to result in the cat's protein being non-functional. Since the protein cannot bond to molecules of sugars or sweeteners, cats simply cannot register the sensation of sweetness. This deletion seems to be unique to the cat family, since other carnivores, such as dogs and bears, have a functioning gene. From what I remember, big cats have this non-functioning gene as well, but it isn't known whether or not the cat allies (such as civets and genets) share this unusual feature.

Though cats aren't able to taste sweetness, this doesn't mean they will avoid it. They are, in fact, completely indifferent to the flavor. So, if your kitty likes something sweet, it's probably going after something other than the sugar. They're quite fond of certain amino acids, so it's possible that's what your kitty enjoys.

Sources Basic Local Alignment Search Tool (BLAST), PLOS Genetics, Journal of Nutrition, and GeneCards. Images are from Wikimedia Commons under Creative Commons licenses: one, two, three.

By the way, BLAST is an amazing tool. Feel free to plug in the ATCG sequence above into their databases to compare the gene for yourself. The programs I used for this post are nucleotide blast and blastx.

Ebon's Mother

To contact us Click HERE
I was finally able to snag a good picture of her for the blog. Most of the pictures I have or can find aren't so great (example). This is Ebon's mother, Hellon, who will be fifteen this Christmas. She has some mobility issues (what dog this age doesn't?), but she's still doing pretty well. I kept miscalculating her age, but I know for sure now. She has the most fascinating graying pattern. I love looking at old dogs and seeing where and when they gray. A lot of them aren't as extensive as this!

Hellon is about sixty pounds and is a retired working dog, retrieving ducks regularly in her younger days. Ebon was the runt from her last litter and ended up being the biggest of them when he finished growing. She was spayed when he was about a year old. She currently lives with a Shih Tzu, but when Ebon was born she had an elderly Pekingese companion. Image is from her owner, used with permission.
 I bet Ebon will look like this one day.

What I've Been Up To

To contact us Click HERE
Obligatory picture of dog being cute
I've been preparing for and taking the GRE.

When I first started this blog I was still intending to go through with my decision to become a high school teacher. One of my main reasons for wanting to do this was that I thought our country needed more well-qualified teachers. My own high school Biology teacher was terrible and made many of my classmates hate the subject, but my senior Zoology teacher (yes, my high school offered it) was amazing. She made me want to be like her. I got into a post-baccalaureate program, began taking courses, and even took the GACE (Georgia Assessment for the Certification of Educators). I did well. I thought it was even kind of fun. Then, I actually got into a classroom full of high school freshmen to observe and realized I hated it. The kids were impossible. It actually depressed me. So, I pulled myself out of the program.

Now, I'm working on applying to PhD programs. My hope is to get a PhD in genetics. I had some apprehension about the teaching program even before I applied to it, but the concept of me going into genetics research is just plain exciting. It's going to be challenging, sure, and I'm going to have to move far away from everyone I know, but that's okay.

I'm hoping to get some new blog posts up quite soon.

Feline's Pride food recalled due to salmonella

To contact us Click HERE

Feline’s Pride Issues Nationwide Recall of its Natural Chicken Formula Cat Food Due to Salmonella Contamination

Contact:
Shelby Gomas,
Tel: 1-716-580-3096

FOR IMMEDIATE RELEASE - July 1, 2010 - Buffalo, NY – Feline’s Pride is announcing a voluntary recall of Feline’s Pride Raw food with ground bone for cats and kittens, Natural Chicken Formula, Net Wt. 2.5 lbs. (1.13 kg., 40 oz.) produced on 6/10/10, because it may be contaminated with Salmonella. People handling raw pet food can become infected with Salmonella, especially if they have not thoroughly washed their hands after having contact with the raw pet food or any surfaces exposed to the product.

When consumed by humans, Salmonella can cause an infection, salmonellosis. The symptoms of salmonellosis include nausea, vomiting, abdominal cramps, minimal diarrhea, fever, and headache. Certain vulnerable populations, such as children, the elderly, and individuals with compromised immune systems, are particularly susceptible to acquiring salmonellosis from such pet food products and may experience more severe symptoms.

Pets with Salmonella infections may be lethargic and have diarrhea or bloody diarrhea, fever, and vomiting. Some pets will have only decreased appetite, fever and abdominal pain. Infected but otherwise healthy pets can be carriers and infect other animals or humans. If your pet has consumed the recalled product and has these symptoms, please contact your veterinarian.

The product is packaged in uncoded plastic containers and sold frozen to private consumers nationwide. Once thawed, the pet food has a shelf life of about 1 week. The firm manufactures the pet food by an as-ordered basis. This recall affects only those orders placed and shipped from June 10 through June 17, 2010.

The firm and FDA are investigating this matter to determine the source of this problem, and will take any additional steps necessary to protect the public health.

To date, both the firm and the FDA have received no reports of Salmonella infection relating to this product.

This product should not be fed to pets but should instead be disposed of in a safe manner (e.g., in a securely covered trash receptacle). People who are experiencing the symptoms of Salmonella infection after having handled the pet food product should seek medical attention, and report their use of the product and illness to the nearest FDA office.

People should thoroughly wash their hands after handling the pet food – especially those made from raw animal protein such as meat or fish -- to help prevent infection. People may risk bacterial infection not only by handling pet foods, but by contact with pets or surfaces exposed to these foods, so it is important that they thoroughly wash their hands with hot water and soap.

Since certain vulnerable populations, such as children, the elderly, and individuals with compromised immune systems, are particularly at risk from exposure they should avoid handling this product.

Consumers with questions should contact the company at (716) 580-3096, Monday –Friday from 10 am - 4 pm EDT.

Feline's Pride expands food recall due to salmonella

To contact us Click HERE
From FDA:

Feline’s Pride Expands Nationwide Recall of its Natural Chicken Formula Cat Food Due to Salmonella Contamination

Contact:
Shelby Gomas,
Tel: 1-716-580-3096

FOR IMMEDIATE RELEASE - July 15, 2010 - Buffalo, NY – Feline’s Pride is expanding its July 1, 2010 voluntary recall of Feline’s Pride Raw food with ground bone for cats and kittens, Natural Chicken Formula, Net Wt. 2.5 lbs. (1.13 kg., 40 oz.) produced on 6/10/10 to include the product produced on 6/21/10, because it may be contaminated with Salmonella. People handling raw pet food can become infected with Salmonella, especially if they have not thoroughly washed their hands after having contact with the raw pet food or any surfaces exposed to the product.

When consumed by humans, Salmonella can cause an infection, salmonellosis. The symptoms of salmonellosis include nausea, vomiting, abdominal cramps, minimal diarrhea, fever, and headache. Certain vulnerable populations, such as children, the elderly, and individuals with compromised immune systems, are particularly susceptible to acquiring salmonellosis from such pet food products and may experience more severe symptoms.

Pets with Salmonella infections may be lethargic and have diarrhea or bloody diarrhea, fever, and vomiting. Some pets will have only decreased appetite, fever and abdominal pain. Infected but otherwise healthy pets can be carriers and infect other animals or humans. If your pet has consumed the recalled product and has these symptoms, please contact your veterinarian.

The product is packaged in uncoded plastic containers and sold frozen to private consumers nationwide. Once thawed, the pet food has a shelf life of about 1 week. The firm manufactures the pet food by an as-ordered basis. This expansion of the recall affects those orders placed and shipped from June 21 through June 26, 2010 (produced on 6/21/10).

The firm and FDA are investigating this matter to determine the source of this problem, and will take any additional steps necessary to protect the public health.

To date, both the firm and the FDA have received no reports of Salmonella infection relating to this product.

People who are experiencing the symptoms of Salmonella infection after having handled the pet food product should seek medical attention, and report their use of the product and illness to the nearest FDA office.

People should thoroughly wash their hands after handling the pet food – especially those made from raw animal protein such as meat or fish -- to help prevent infection. People may risk bacterial infection not only by handling pet foods, but by contact with pets or surfaces exposed to these foods, so it is important that they thoroughly wash their hands with hot water and soap.

Since certain vulnerable populations, such as children, the elderly, and individuals with compromised immune systems, are particularly at risk from exposure they should avoid handling this product.

Consumers with questions should contact the company at (716) 580-3096, Monday -Friday from 10 am - 4 pm EDT.

11 Aralık 2012 Salı

Cats don't Prefer Sweets

To contact us Click HERE
Cats taste the world very differently than humans

One thing that I found fascinating during my undergraduate studies was my Modern Biology class. It involved learning about and implementing numerous techniques that are rather new to the field of biology. Thanks to this class, I isolated a number of different cell components, ran various biological molecules through a gel electrophoresis machine, and performed polymerase chain reaction. I also took my own DNA and prepared it for sequencing, which involved refining and isolating the material, cutting out the gene we wanted to look at, then replicating it so that it could be sent off for the actual sequencing process to be performed.

The gene that we looked at was one of the two that go into making the receptors on your tongue that register sweetness. Specifically, the TAS1R2 (taste receptor, type 1, member 2) gene. TAS1R2 must join up with a second protein to signal that sweet flavor. Here is the TAS1R2 gene (specifically, my copy) in its three hundred fifty-five nucleotide entirety: 
GCTGCGTACCACACCCAGCGCCGACCACCACATCGAGGCCATGGTGCAGCTGATGCTGCACTTCCGCTGGAACTGGATCATTGTGCTGGTGAGCAGCGACACCTATGGCCGCGACAATGGCCAGCTGCTTGGCGAGCGCGTGGCCCGGCGCGACATCTGCATCGCCTTCCAGGAGACGCTGCCCACACTGCAGCCCAACCAGAACATGACGTCAGAGGAGCGCCAGCGCCTGGTGACCATTGTGGACAAGCTGCAGCAGAGCACAGCGCGCGTCGTGGTCGTGTTCTCGCCCGACCTGACCCTGTACCACTTCTTCAATGAGGTGCTGCGCCAGAACTTCACTGGCGCCGTGTGG
...not really that interesting.

This is your average TAS1R2 gene for Homo sapiens, nothing special. Just about every human out there has this exact sequence, with few exceptions (one of my classmates, for example, had a single point mutation). However, it is one gene crucial to why humans like sweets so much. This is what the gene looks like after it's been translated into its protein form (the letters are standard for amino acids):
Query  2    LRTTPSADHHIEAMVQLMLHFRWNWIIVLVSSDTYGRDNGQLLGERVARRDICIAFQETL  181            LRTTPSADHHIEAMVQLMLHFRWNWIIVLVSSDTYGRDNGQLLGERVARRDICIAFQETLSbjct  82   LRTTPSADHHIEAMVQLMLHFRWNWIIVLVSSDTYGRDNGQLLGERVARRDICIAFQETL  141Query  182  PTLQPNQNMTSEERQRLVTIVDKLQQSTARVVVVFSPDLTLYHFFNEVLRQNFTGAVW  355            PTLQPNQNMTSEERQRLVTIVDKLQQSTARVVVVFSPDLTLYHFFNEVLRQNFTGAVWSbjct  142  PTLQPNQNMTSEERQRLVTIVDKLQQSTARVVVVFSPDLTLYHFFNEVLRQNFTGAVW  199 
This is a comparison showing my own protein versus the average human. It's a perfect match and codes for a fully functional receptor protein. This gene is seen in a very wide variety of different animals, and the shared genetic material is quite astounding, allowing for countless species to have the ability to taste sweetness.

A cat enjoying a fresh fish

So, why am I talking about humans a post about cats? Well, let's compare the sequence above to the equivalent gene in a cat. The "query"line is the human gene again, and the "sbjct" or subject line is the equivalent gene in Felis silvestris catus.
Query  2    LRTTPSADHHIEAMVQLMLHFRWNWIIVLVSSDTYGRDNGQLLGERVARRDICIAFQETL  181            LRT P+ +H   AM  ++ +FRWNW+  + + D YGR   +   E    RDICI F E +Sbjct  184  LRTIPNDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKFREEAEERDICIDFSELI  243Query  182  PTLQPNQNMTSEERQRLVTIVDKLQQSTARVVVVFSPDLTLYHFFNEVLRQNFTGAVW  355                 +Q    EE Q++V ++   Q STA+V+VVFS    L     E++R+N TG +WSbjct  244  -----SQYSDEEEIQQVVEVI---QNSTAKVIVVFSSGPDLEPLIKEIVRRNITGRIW  293
Cat tongue anatomy
Overall, the genes are fairly similar, but with one major difference. I'm not going to get too complicated with this, but the dashes you see indicate amino acids that are absent in the final protein found in cats but present in humans: a deletion. Changes in a protein don't necessarily result in a change in its functionality, but that deletion is enough to result in the cat's protein being non-functional. Since the protein cannot bond to molecules of sugars or sweeteners, cats simply cannot register the sensation of sweetness. This deletion seems to be unique to the cat family, since other carnivores, such as dogs and bears, have a functioning gene. From what I remember, big cats have this non-functioning gene as well, but it isn't known whether or not the cat allies (such as civets and genets) share this unusual feature.

Though cats aren't able to taste sweetness, this doesn't mean they will avoid it. They are, in fact, completely indifferent to the flavor. So, if your kitty likes something sweet, it's probably going after something other than the sugar. They're quite fond of certain amino acids, so it's possible that's what your kitty enjoys.

Sources Basic Local Alignment Search Tool (BLAST), PLOS Genetics, Journal of Nutrition, and GeneCards. Images are from Wikimedia Commons under Creative Commons licenses: one, two, three.

By the way, BLAST is an amazing tool. Feel free to plug in the ATCG sequence above into their databases to compare the gene for yourself. The programs I used for this post are nucleotide blast and blastx.